KEGG   Prunus persica (peach): 18768449Help
Entry
18768449          CDS       T03092                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pper  Prunus persica (peach)
Pathway
pper00520  Amino sugar and nucleotide sugar metabolism
pper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    18768449
Enzymes [BR:pper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     18768449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 18768449
NCBI-ProteinID: XP_020425797
Position
G8
AA seq 444 aa AA seqDB search
MGSELIFRGHEAQHVADTYSPKPPKPWASVTRPIGYLLREQRLVFVLVGIAIATVGFTLL
PSSRSPYVNGNVPISNEYVRYDFDSSTHLTHKPAYERRFGLTNWNSGGKVPLGLKRKGLR
IVVTGGAGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLL
LEVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRIGARFLLTSTSEVYGDPL
QHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGAGVEVRIARIFNTYGPRMCIDD
GRVVSNFVAQALRKEPMTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVGPFNLGNPGEFT
MLELAKVVQETIDPDAKIEYRPNTEDDPHKRKPDITKAKDLLGWQPKVSLQKGLPLMVSD
FRKRIFGDHKEAGSTTTPTTTTTM
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggagctcatcttcagagggcacgaggcccaacacgtggccgacacctactcg
ccgaaaccgccaaagccatgggcctctgtgacccgcccgattgggtacttgctccgagag
cagcgcctcgtcttcgtgctcgtcggcattgctatagccaccgtcgggttcacgctcctc
ccgtcctctcgctctccttacgttaacggcaacgtcccgatctcgaacgagtatgttagg
tacgacttcgattcgtcgacccatttgacgcacaagcccgcttacgagcgccggttcggg
ttgacgaactggaattcgggtgggaaggtgccgctggggctgaagagaaaggggctccgg
atcgtggtgacgggtggggccggatttgtcgggtcgcaccttgtggaccgtctgatagag
cgaggggacagcgtgatcgttgtggacaatttcttcaccggcaggaaagagaacgtaatg
caccatttcgggaaccccaggttcgagctcatccgacatgacgtcgttgagcctcttctc
ctcgaagtcgaccagatctaccatctcgcttgccctgcctcccctgtccattacaagttc
aaccccgtcaagactattaaaaccaatgtggtggggactctgaacatgctgggtctagcg
aagaggatcggagcgcggttcttgctaaccagcaccagtgaggtgtacggtgatcctctg
cagcacccgcaggttgaaacctactggggcaacgttaatccaatcggtgtccgaagttgt
tacgacgagggaaaacgtacggccgagacattgaccatggactaccacagaggagccgga
gttgaggttaggattgctaggatttttaacacttatgggccaagaatgtgcatagatgac
ggccgtgttgttagtaactttgttgcccaggcgttgaggaaagagcctatgactgtttat
ggagatgggaagcagacaaggagtttccaatatgtttctgatctggtggaaggtctaatg
cgcctgatggaaggcgaacatgttggaccattcaatctcgggaatccgggtgaattcacc
atgcttgaacttgcaaaggtggttcaagaaacaatcgacccagatgcaaagatagagtac
aggcccaacacagaggatgacccccacaagaggaagcctgatatcacaaaggctaaagac
ttacttggttggcaaccaaaggtgtccctgcaaaagggtctccctctcatggtctcagac
ttcaggaagcgcatctttggtgaccacaaggaagctggctctaccaccacccccaccacc
accaccaccatgtaa

DBGET integrated database retrieval system