KEGG   Prunus persica (peach): 18771235Help
Entry
18771235          CDS       T03092                                 

Definition
(RefSeq) probable glycosyltransferase At5g20260
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
pper  Prunus persica (peach)
Brite
KEGG Orthology (KO) [BR:pper00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pper01003]
    18771235
Enzymes [BR:pper01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     18771235
Glycosyltransferases [BR:pper01003]
 Polysaccharide
  Structural polysaccharide
   18771235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Orbi_VP4
Motif
Other DBs
NCBI-GeneID: 18771235
NCBI-ProteinID: XP_020424705
Position
G7
AA seq 334 aa AA seqDB search
MEERLKVWIYREGEPPLVHDGPLNNIYGIEGQFIDEMESGKSRFMARHPDEANLFLIPIS
VVNIVNTLYNPLVTYSRDQLQRVVLDYIGIISERYPYWNRSQGADHFLVSCHDWAPDISE
ANPKLYDKFIRVLCNANTSEGFKPQRDVSIPEINIPYGKLGPTPQRASPDKRSILAFFAG
GAHGNIRHILLEHWKDKDKEVQVHEYLDKKKNYFKLMGKSKFCLCPSGYEVASPRVVTAI
SVGCVPVLISDYYALPFSDVLDWTKFSVYIPSEKIPEIKTILKGISPKRYLKLQKRVTEV
HRHFMIHRPAQPYDMIHMLLHSVWLRRLDVLLPS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaagattgaaggtgtggatttacagggaaggagagcctcccttggtccacgac
gggccgttgaacaacatctacggcatcgaagggcagttcatcgacgagatggagagcggc
aagagccgcttcatggctcgtcatcctgatgaggccaacctgttcctcatccctatcagt
gtggtcaacattgtcaacactctttacaatcctcttgtcacttactcccgtgatcagcta
caaagggtggttttggattatattggcattatatctgaaagatacccttactggaataga
agccaaggtgctgaccatttcttagtttcttgccatgattgggcaccggacatttcagaa
gcgaaccctaagctctacgacaagttcataagagttttatgcaatgccaatacctcggaa
gggtttaagccccaaagagatgtctcaattccagaaatcaacataccctatggaaaactt
ggtccaaccccacagcgtgcaagccctgataagcgttccattctcgccttcttcgctggc
ggtgctcacggtaacataaggcatatcttgctcgagcattggaaagacaaagacaaagaa
gtgcaagtgcatgagtaccttgacaagaagaaaaattacttcaagttaatggggaagagc
aagttttgcttgtgcccaagtgggtatgaagtggcaagtccaagggtggtcacagcaatt
tctgtggggtgtgtccctgtcctcatttctgactactatgcattgccctttagtgatgtt
cttgattggaccaaattttccgtgtacattccatcagaaaaaataccagaaatcaagaca
attttgaaaggaatttcccccaaaaggtatttgaaactgcaaaaaagggtgacagaggtg
cacaggcatttcatgattcatcgaccagctcaaccttatgatatgatccacatgttgctt
cactcggtttggctgagaaggcttgatgttttgctgccatcttga

DBGET integrated database retrieval system