KEGG   Prunus persica (peach): 18771596Help
Entry
18771596          CDS       T03092                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pper  Prunus persica (peach)
Pathway
pper00052  Galactose metabolism
pper00500  Starch and sucrose metabolism
pper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    18771596
   00500 Starch and sucrose metabolism
    18771596
Enzymes [BR:pper01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     18771596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 18771596
NCBI-ProteinID: XP_007204106
UniProt: M5WEW9
Position
G7
AA seq 578 aa AA seqDB search
MDTLKKFLQVLLLACCCVFVIKNDAVEASHNVYPEFQSLAAVKVNRVHRTAFHFQPPSNW
INDPNGPMYFGGLYHLFYQYNPKGAVWGNIVWAHSVSKDLINWEALEPAIYPSKPFDING
CWSGSATILPGNKPIILYTGIDPQNRQVQNYAIPANASDPYLRQWIKPDNNPLVVPDAGM
NATAFRDPTTAWWIDGHWKMLVGGRRKHRGVAHLYRSKDFMHWVKAHHPFHSAPHTGMWE
CPDFYPVPLVGKFGLDTSNFGVDVKHVMKVSLDETRYEYYTIGKYFLEKDRYVPDKALVD
GWSGLRYDYGNFYASKSFFDPAKSRRILWGWANESDTSQEDVAKGWAGIQTIPRVVWLSP
DRKQLLQWPIEELETLRGQKVELNIQKLKLGDYVEVKGITAAQADVDVLFSIPSLDKAED
FDPSWTSLDAQRLCGLKGSKVQGGLGPFGLLTLASQNLEEFTPVFFRIFKAQGSRHLVLM
CSDATSSSLQNNLYKPSFAGFVDIDLTSYKKLSLRSLIDHSVVESFGPGAKTCITSRVYP
TLAVNKEAHLFVFNNGTETITVESLTAWSMNAPKQMNA
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggatactttaaaaaagttccttcaagttcttttacttgcttgttgttgtgtttttgtc
ataaaaaacgacgccgtcgaagcatcacacaacgtttaccccgagtttcagtctcttgct
gccgtcaaagtcaaccgagtccacagaactgcgtttcactttcaacctccaagcaactgg
attaacgaccctaatggacctatgtactttggtggtctgtatcacttgttctatcagtac
aatcccaaaggtgcggtttggggcaacattgtttgggcccattcagtgtccaaggatctg
atcaattgggaagctcttgagcctgcaatatacccgtccaagccctttgacataaatgga
tgttggtccgggtccgccactattctccccggcaacaagcccattatcctctacactgga
atcgacccccaaaaccgccaggtccaaaactatgccatcccggcaaacgcatccgacccg
tacctccgccaatggatcaagcccgataacaaccctctagtggtcccagatgccggtatg
aacgcaaccgcattccgcgacccgacaacagcttggtggattgatgggcattggaagatg
ttggtgggtggcagaaggaagcatagaggagtggcccatttgtataggagcaaggacttc
atgcattgggtcaaggcccatcacccatttcactcggctccccatacgggtatgtgggaa
tgcccggatttttacccggttccattggttggcaaatttgggttggacacatcaaatttt
ggtgtggatgttaagcatgttatgaaagtgagccttgatgagactaggtatgaatattac
acaattggaaaatattttcttgagaaagataggtatgttcctgataaagccttggtggat
ggttggtctgggttgagatatgactatggcaacttttatgcatccaagagtttctttgat
cctgcaaagagtaggagaattttgtgggggtgggctaatgagtctgatacatctcaagaa
gatgttgctaagggatgggccggaattcagacaataccaagggtggtgtggctcagtcca
gataggaaacaattgttgcaatggcctattgaagaactagaaactctaagagggcaaaaa
gtcgagttgaacattcaaaagctcaaactaggagattatgttgaagttaaaggaataact
gcggctcaggccgatgttgatgttctcttctcaatccctagcttggacaaagccgaagat
tttgaccctagctggaccagcctcgatgcccaaagactttgtggcctaaagggttcaaaa
gttcaaggtggcctcgggccttttggacttttgacattagcatcacaaaacctagaggaa
ttcactcctgttttcttcaggatttttaaagctcaaggcagcaggcacctagttctcatg
tgctctgatgcaacaagttcgtctttgcagaacaacctgtacaaaccatcatttgctggc
tttgtggatatagatttgacttcttacaagaagctttccctcaggagtttgattgatcat
tctgttgttgaaagttttggacctggagcaaaaacatgcatcacatctagggtttatcca
actctagcagttaacaaggaagctcacttgtttgtgttcaacaatgggactgagactatt
actgtagagagcctcactgcatggagtatgaatgctcctaaacagatgaacgcatag

DBGET integrated database retrieval system