KEGG   Prunus persica (peach): 18771694
Entry
18771694          CDS       T03092                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pper  Prunus persica (peach)
Pathway
pper00100  Steroid biosynthesis
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
Module
pper_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    18771694
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     18771694
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 18771694
NCBI-ProteinID: XP_007202081
UniProt: M5W8Z7
Position
G7
AA seq 369 aa
MDLGHVLHLLIPSWNSVAILALFFAYLSIAGSILPGKVVPGATLPDGSRLYYRCNGLLSL
LLLVGLLGFGAKMDFVSLTAISDRGFELLSTTFLFSVLVTLVLYAAGCKSSNRGSSLKPH
VTGNLLHDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLFINLSVLARSIQDGTLSQSMILF
QLFCALYILDYFFHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKVELG
TAAVVANCLTFLIGYMVFRGANKQKHVFKKNPKAPIWGRPARVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLVWRERRDEARCAEKYKEIWAEYRKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggtcatgttctccacctcctaattccctcatggaactctgttgctatactc
gcattgttctttgcttacttgtccattgccggatctatattgcccggcaaagttgttccc
ggagccaccttaccagatggctctcgtctttattatcgctgcaatggtctgctatcgctt
ctgttgctggttgggcttcttgggtttggtgctaagatggatttcgtatcacttactgca
atatcagacagaggatttgagctgttatcaacaacttttctgtttagtgttctggtcaca
ctggtactttacgctgctggctgcaagtcgagcaaccgaggttcttccctaaagcctcat
gtgacagggaaccttctacatgactggtggtttggaatacagcttaatcctcagtttatg
ggcatcgacctcaaatttttctttgttagagctggaatgatgggctggctttttatcaac
ctttcggttcttgcgagaagtatccaagatggcaccttgagtcaatccatgatcctcttc
cagttgttctgtgcgttatacatcctggactacttttttcatgaggagtacatgacctcc
acatgggacataattgcagagagactgggtttcatgcttgtatttggagatctagtgtgg
attcctttcacttttagcatccagggatggtggcttctgagtaacaaggtggagttagga
acagctgctgttgtagcaaattgtttgacttttctgatcgggtacatggtattcagagga
gccaacaagcaaaagcatgtctttaagaagaatcctaaagcacctatatggggtaggcct
gcaagggtcattgggggaaagttgcttgcttctggttattggggaattgcaaggcactgt
aattaccttggggatttgttacttgcactgtctttcagcttgccgtgtgggataagttcc
ccagttccgtacttctatccaatttatcttctcattctgcttgtatggagagaaagaaga
gatgaagctcgttgtgcagagaagtacaaagaaatctgggcagaataccgcaaacttgtc
ccatggagaatattgccttatgtttattaa

DBGET integrated database retrieval system