KEGG   Prunus persica (peach): 18772014Help
Entry
18772014          CDS       T03092                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pper  Prunus persica (peach)
Pathway
pper03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pper00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    18772014
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pper03041]
    18772014
Enzymes [BR:pper01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     18772014
Spliceosome [BR:pper03041]
 Complex C
  Other components
   Step II factors
    18772014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD AAA_22 zf-C3HC4 ResIII AAA_19 Helicase_RecD AAA_30 zf-RING_UBOX ABC_tran RsgA_GTPase Herpes_ori_bp AAA_29
Motif
Other DBs
NCBI-GeneID: 18772014
NCBI-ProteinID: XP_007208142
UniProt: M5W7P8
Position
G6
AA seq 1724 aa AA seqDB search
MRSSCGPYPRATFRQPQPPEIPHRYPPRQPNYRPDGCCRRPPPRPPSFIVVLLSDQRNRR
TADIDAVIAKCKFKPENVEFSPSNVIVVSLFYTQWVHALEAIVCLWESRLDRVHNLTPKL
NRFVSVPSDLEELQDRLRGLFTERIKKLIDGEAVKKWEEKRAQLSKEFDRVSKLLLRPSP
VWTLDDLAQKKRRSKCEMELVESKIREFKSAMNCLLAYLDGNELEGCGEEGVQVFKFSRE
VYDWGRIQSIMARECHRLEEGLPIYAYRQQILQQILTQQVLVLIGETGSGKSTQLVQFLA
DSGIAAEQSIVCTQPRKIAATSLAERVTQESSGCYREKSIKFNPTFLSGQELNSKVIFMT
DHCLLQHYMNDMNMSGISCIIIDEAHERSLNTDLLLALIKGLLGRRPSLRLVIMSATADA
EVLSNYYYGCGIFSVVGRSFPVDVRYKPSFSEGTSSDATSYVSDVLRVATEVHKKEKEGT
ILAFLTSQMEVEWACQKFIAPGAIALPLHGKQTFEDQYNVFQSYPGRRKIIFATNLAETS
LTIPGVKYVIDSGMAKESKFEPASGMNVLRVCRISRSSANQRSGRAGRTEPGICYRLYSK
NDFEAMPPCQEPEIRRVHLGVAVLKILALGIKNLKDFEFIDAPCSEAIDMAMRNLIQLGA
VKQTDDVFELTKDGRFLVKLGVEPRLGKLILGCYNHSLRREGLVLAAVMANSSSIFCRVG
NDEEKLRSDCLKVQFCHRDGDLFTLLSVYKTWDNLAQEKKNTWCWENSINAKTMRRCQEM
VKDLESCLKHELNMIIPSTWCWNPHESNDCDKYLKKVILSSLVENVAMFSGHDQLGYEVA
LSGQHVRLHPSCSLLVFGEKPSWVVFGELLSISNQYLVCVTSIDFNTLSTLCPPPLFDVS
KMESQKLQLKVLTGFGSTLLKRFCGKGNCYLLHLVSRVRSICKDERINIKVDYYQNEITL
FATLHDRDRVSSFVYDALECERKWMRNECLEKCLYHGSGVLPSIALFGAGAEIKHLELQK
RCLTVDVVHSKLDSMDDKELLSELEKYASGSICAIHKFTGTGQESVDKGKSARITFLSPD
VAQKAVELNESEFSGSILKVIPSQVGGDRKMLSFPAVRAKVYWPRRLSRGIAIVKCDVDD
VAYMVNDFFNLLVGGRIVRCETSKRYKDSVVISGLEKDLSEAEILDVLRTATSRRILDFF
LLRGDAVENPPCGACEDALLKEISTFMPKRYSHNSCSIQVFEPEQKNAFMRALITFDGRL
HLEAAKALEQLEGKVLPGFLSWQKMKCQQLFHSSLSCPAPVYPVIKKQLDSLLSSFVQLN
GVEWSLDRNANGSYRVKISANATKTVADLRRRVEELVKGKTIDHASLTPTILQLLFSRDG
IALMHSLQRETGTYILFDRRNVSVQVFGSSDQVGVVQQKLVDSLLTLHENKLIEIRLQGS
ALPPELMKEVINRFGADLHGLKEKVPGADFSLNVRRQVISIHGNKDLKQKVEDNIYEIAQ
MTGSSTERFNSEADCPICLCEIEDEYRLAVCGHLFCRLCLVEQCESAIKNQDSFPMCCAH
EGCRSLIVFSDLRYLLSSEKLEELFRASLGSFIASSGGNYRFCPSPDCSSVYQVAAPGTD
GEPFVCGACYAETCTRCHLEYHPYLSCEQYREFKEDPDSSLKEWCKGKEHVKSCPVCRYT
IEKIDGCNHIECRCGKHICWVCLASYGTSNECYDHLRSVHMAII
NT seq 5175 nt NT seq  +upstreamnt  +downstreamnt
atgagatcgtcgtgcggaccataccctcgcgccactttccgccaacctcagccgccggaa
attccccaccgataccctcccaggcaacccaattaccggccggatggctgctgccgtcga
ccccctcccaggcccccgagcttcatcgtcgtgctcctctccgaccaacgtaaccgccgg
acagccgacatcgacgccgtgatcgctaaatgcaagttcaagcccgaaaacgtcgagttc
tctccctctaatgtcatagtggtctccttgttctacacacaatgggtccacgcgctcgag
gccattgtttgtctttgggaatcgcggctcgaccgggttcataatctgacaccgaagttg
aaccggtttgtttctgtgccgtccgatctcgaggagctccaggaccggctcagaggcttg
ttcacggaaagaattaagaaattgattgacggggaagcagtgaagaagtgggaggagaag
cgggcccagttgtctaaggaatttgatcgagtttcgaagttacttctgaggccaagccct
gtttggactctggatgacttagctcagaagaagaggaggagtaaatgcgaaatggaattg
gtggagagtaagattagggagttcaagtcggcaatgaactgtttgcttgcttatcttgat
gggaacgagttggaggggtgtggtgaagaaggcgtgcaagtgtttaaattttcacgtgaa
gtttatgattggggtcgaattcagagcataatggctcgggagtgccacagactcgaagaa
gggttgcccatttacgcttatcggcagcaaattcttcagcaaattcttacccagcaggtc
ctggtgttaattggagaaactggttcaggaaagagtacacagttggtgcagtttcttgcc
gattctggaattgctgctgagcagtctattgtatgcactcagcctcgcaagattgctgcc
acgtcgttggccgaaagggttacacaagaaagtagtgggtgttatagagaaaagtcaata
aaatttaatccgacatttttgtcagggcaggagttgaattctaaggtaatatttatgaca
gaccactgtctactgcagcactacatgaatgatatgaatatgtctgggatttcttgcatc
attattgatgaggctcatgaaaggagcttgaatactgatctccttttggcattgatcaaa
ggtttactaggtcgaagacctagtttacgacttgttataatgtctgcaacagctgatgca
gaagtgctttcaaattattattatggctgtggaatcttttctgtggtggggaggagcttt
cccgttgatgttagatataaaccatctttcagtgaaggaacttctagtgatgctacttcc
tatgtttctgatgtgctgagggtagcaacagaggtacacaaaaaagagaaagaagggaca
attcttgcctttttgacttcccagatggaagtagaatgggcttgtcagaagtttatagca
cctggtgcaattgcactgccactgcatggaaaacaaacttttgaagaccaatataatgtt
ttccaaagctaccctggaagaagaaaaattatatttgccacaaatctggctgagacatct
ctgacaattcctggggtaaagtatgtgattgattctggtatggctaaagaaagcaaattt
gaacctgcaagtggcatgaatgttctaagagtttgcaggatcagccggagttctgctaat
caaagaagtggccgtgctggaagaacggaacctggtatatgttatagactctactcaaaa
aatgattttgaggcgatgcctccttgccaggaacctgagatccgtagagttcaccttggt
gttgcagttctgaagattttggctttgggcatcaagaatttaaaagattttgaatttatt
gatgcaccttgttctgaagctattgacatggccatgcggaaccttattcagttaggagct
gtgaagcaaactgatgatgtttttgaattaactaaggacggtcggttcttggttaaattg
ggtgttgagcctcggcttggtaaattaatccttggttgttataaccacagcttacgtagg
gaaggccttgttcttgcagctgtaatggcaaattccagtagtatattttgtagagttggt
aatgatgaagaaaaacttagatcagactgtcttaaggtgcaattttgccatcgtgatggg
gatctctttacccttctctctgtgtataagacatgggataatttggctcaagagaagaaa
aacacatggtgttgggaaaacagcattaatgccaaaactatgaggagatgccaagaaatg
gtaaaggatttggagtcttgccttaaacatgaactcaatatgataattcctagtacctgg
tgttggaatccacatgaatcaaatgattgtgataaatatttgaaaaaggttatactttct
tcccttgtggaaaatgttgctatgttctcgggacatgatcaacttggttatgaagtggca
ttaagtgggcaacatgttcggttgcatccttcgtgttcattgttagtatttggtgagaaa
cctagttgggtggtatttggtgaactcctgtcaatttctaatcaatatttagtctgcgtc
acttccattgatttcaacactttgtctaccctatgtcctcctcctttgtttgatgtatct
aagatggaaagtcaaaaattgcaactgaaagttttgactggttttggaagtactctgctt
aaaagattttgtgggaagggcaactgttatctgcttcatcttgtttcacgtgttaggtca
atttgcaaggacgaacgtatcaacattaaagtcgattattatcagaatgagattacgttg
tttgccaccttgcatgacagggatagggtttcaagctttgtatatgatgccttggagtgt
gaacgaaaatggatgcgaaatgaatgtttggagaaatgcttgtatcatggttctggtgtc
ttgccctcaatagcattgtttggagctggtgctgagatcaagcatctggagcttcaaaaa
aggtgtttgactgttgatgtagttcattcaaaactagattccatggatgataaggagtta
cttagtgagcttgaaaagtatgcctctggtagtatatgtgctattcataagttcactggc
actgggcaggaaagtgttgataaaggaaagtcggccaggataacatttttaagtcctgat
gtggctcaaaaagctgttgaactaaatgaatctgaatttagtggctccatactgaaggtt
attccttctcaggttgggggtgatcgtaaaatgttgtcgttccctgctgttagagctaaa
gtttattggcctcgtaggctaagcagggggattgcaattgtcaaatgtgacgtggatgat
gttgcttacatggttaatgatttttttaaccttttagtaggaggaagaattgttcgttgt
gaaactagcaaaagatacaaggattctgttgtgatcagtggacttgaaaaagatctttct
gaggctgaaattttggatgtgttgaggactgccacaagtaggagaatcctggattttttt
ctgctgagaggagatgctgtagaaaatccgccatgtggtgcttgtgaagatgctctccta
aaagaaatatcaacctttatgcctaaaaggtactcccacaatagctgcagcattcaggtt
ttcgagcctgaacaaaagaatgctttcatgagagctttgattacatttgatggaagatta
cacttggaggcggcaaaagctttggaacaattagaagggaaagtattgcctgggttcctt
tcatggcaaaagatgaagtgccagcagttatttcatagctctctatcctgccctgcccct
gtttatcctgtgatcaagaagcagttggattcgttactttcaagttttgttcaactaaat
ggtgtagaatggagtttagataggaatgctaatggctcctacagagtgaagatatctgcc
aatgctacaaaaacagttgcagacctcagaagacgtgtggaggagcttgtgaaagggaag
acaatagaccatgccagcctcactccaactattttacagcttctgttctccagagatggc
atcgctctaatgcactcactacagagagagacgggaacctatattctttttgacaggcgt
aacgtcagtgtacaggtcttcggttcttcagaccaagttggtgtggtccagcagaaattg
gttgactcccttttaacactccatgaaaataagctgattgagatccgacttcaaggtagt
gccttacctcccgagttgatgaaagaggttattaacaggtttggggcagacctccatggg
ctcaaagagaaggtaccaggggctgattttagtctaaatgttcgccgtcaagtcatttcc
attcatggaaacaaggatttgaagcagaaagtagaagataatatttatgagattgcacag
atgacaggtagttcgactgagaggtttaatagtgaagctgattgccccatatgtttgtgt
gagattgaagatgaataccggcttgcggtgtgtgggcatttattttgtcgtttgtgtttg
gtggagcagtgcgagtctgcaataaaaaaccaagatagtttcccaatgtgctgtgcacat
gagggttgcaggtctcttattgtgttcagtgatctgagatatctcttatcaagtgagaag
ctggaggagctctttagggcctcattgggatcatttattgcgtcaagtgggggaaactac
aggttttgcccttctcctgactgctcgtctgtgtatcaggtagctgctcctgggacagat
ggtgaaccattcgtatgtggtgcatgttatgccgagacatgtacccggtgccatttagaa
tatcatccatacctgtcgtgcgagcagtaccgggagttcaaggaagatccagattcatca
ttgaaggagtggtgcaaaggaaaagaacatgtgaagagctgcccggtatgcaggtataca
attgagaagatagatgggtgcaaccatatagaatgtaggtgtgggaagcatatttgctgg
gtgtgcttggcgtcttacggaaccagcaatgaatgctatgaccatttgaggagtgttcac
atggccatcatttga

DBGET integrated database retrieval system