KEGG   Prunus persica (peach): 18772743Help
Entry
18772743          CDS       T03092                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK5
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pper  Prunus persica (peach)
Brite
KEGG Orthology (KO) [BR:pper00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pper01001]
    18772743
   01009 Protein phosphatases and associated proteins [BR:pper01009]
    18772743
Enzymes [BR:pper01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18772743
Protein kinases [BR:pper01001]
 Serine/threonine kinases: Other
  Wnk family
   18772743
Protein phosphatases and associated proteins [BR:pper01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     18772743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 18772743
NCBI-ProteinID: XP_020422368
Position
G6
AA seq 623 aa AA seqDB search
MNTTRLGRTCADGGKPQLPAYVETDPSGRYGRFREMLGKGAMKTVYKAFDEVLGMEVAWN
QVKLKDVFGSPDELQRLYSEVHLLKNLNHDSIIQYYMSWIDANRRTFNFITEMFTSGTLR
EYRQKYQRVNIGAVKNWARQILRGLAYLHKLDPPVIHRDLKCDNIFVNGHLGQVKIGDLG
LAAVLRGSHHAHSVIGTPEFMAPELYEEEYNELVDIYAFGMCVLEMLTSEYPYSECSNPA
QIYKKVTSGKLPNAFYKIEDLEAQRFVGKCLENASKRLPAHELLLDPFLASDDRELLSTP
RIPFQNLMPNDDSAVVEVEEEEEEEEEEEEEELPLDLGVDLKRSTNMIITGKMNPEDDTI
FLKVQISDRDGQNARNIYFPFDIVNDTAIAVATEMVKELEISDWEPSEIAEMIEKEISSL
IPGHKKWGTPQDYHAHRHSFNYEDEDDDHDHGHHPFYSFSSCSSSQNSLHAFSSHCKTQF
DCGENISNDQDWLQGDLFINDDASSQSSFSSCNHSNINYFSGTEDDHHDLISCFGKSHKS
RFCPSESRAANCYKHCNSQLHHQRPHELNHPLCHHQRKLPRIQSLIDVRSQLLHRSLVEE
INKRRLFKTVGAVENIGFQTPGS
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccacccggttgggaaggacgtgtgccgatggaggcaagccacagttgcctgca
tacgttgaaacggatccatctggtcgctatggacgtttcagggaaatgcttggcaaagga
gccatgaagacagtttacaaggcatttgatgaggtcctgggaatggaggtggcttggaac
caagtcaagctcaaagatgtctttggttcgccggacgaacttcagcgtctctactcggag
gtgcacctcctcaagaacctcaaccatgactccatcatccaatactacatgtcttggatc
gacgccaatcggagaaccttcaacttcatcaccgaaatgttcacctccggcaccctcaga
gagtacagacagaagtaccagcgagtgaatattggagcagtgaaaaattgggctcggcag
atcttgcgtggacttgcctatctgcacaaacttgatccacctgtgattcacagagacctt
aagtgtgacaacatctttgttaatggccatcttgggcaagtcaagattggtgatttgggt
ttggcagctgttcttcgtggttcccatcatgctcacagtgtcataggtactccggaattt
atggcacccgaattatacgaggaggaatataatgagctagtagacatatacgcctttggc
atgtgtgtgctggaaatgctcacttcagaatatccatatagcgagtgctcaaatcctgcc
caaatttacaagaaagtgacttcagggaagctaccaaacgcgttctacaagattgaagat
ttggaggcgcaacgatttgtagggaagtgtttggaaaatgcctcaaagaggttgccagca
catgagctcttgcttgacccttttctagcctctgatgatagagagctgctgtccacccca
agaatcccatttcaaaacttgatgcctaatgatgattcagcagtggtggaggtggaggag
gaggaggaggaggaggaggaggaagaggaagaggagctacctttggacttgggggttgat
ttgaaaagaagcacaaacatgatcattactgggaaaatgaatccagaggatgatacaatt
tttctcaaagttcagatttcggaccgggatgggcaaaatgctaggaacatatactttccc
tttgacattgtgaacgacactgcaattgctgtagcaacggagatggtgaaagagctagaa
atcagtgactgggaaccttcggagatcgcggagatgatagaaaaagagatatcttcttta
attccaggtcataagaaatggggcacaccccaggattatcatgctcatcggcacagcttt
aactatgaagatgaagatgatgatcatgatcatggtcaccatcctttctactctttctcc
tcctgttcttcctcccaaaactctctccatgctttcagctctcactgtaagacccaattc
gattgcggggagaacatttctaatgaccaagattggcttcaaggtgatctgtttatcaat
gatgatgcaagttctcagagctccttcagctcctgcaaccactccaacataaactacttc
tcaggcactgaagatgaccaccatgacttaatctcttgctttggaaagagccacaaatct
agattttgtccttcagaaagcagggctgcaaattgctacaaacactgcaattcacagctg
catcatcagagacctcatgaattaaatcatcctctttgtcatcatcaaaggaaactaccc
aggattcaatcgcttatagacgtgcgaagccaattgttgcaccggtcactggtggaggag
atcaacaagaggcggttgtttaagactgttggggctgtggagaacattggatttcaaaca
ccaggaagctag

DBGET integrated database retrieval system