KEGG   Prunus persica (peach): 18773086Help
Entry
18773086          CDS       T03092                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
pper  Prunus persica (peach)
Brite
KEGG Orthology (KO) [BR:pper00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    18773086
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     18773086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 18773086
NCBI-ProteinID: XP_007205047
UniProt: M5VYR0
Position
G6
AA seq 501 aa AA seqDB search
MAWFRSLIQVSATARSATKPRISDPFSYTLLSRFSSEPAPIHETPAPQPPTQYSGLGPTK
PGEKPRVVVLGTGWAGCRLMKGLDTDIYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAE
PIGRIQPAISREPGSYFFLSNCVGLDPDKHLVQCETVTDGAEPLKPWKFEISYDKLVIAL
GAKPTTFGIQGVEEHAIFLREVYHAQEIRRKLLLNLMLSDVPGVSEEEKSRLLHCVVVGG
GPTGVEFSGELSDFIQRDVRQRYSHVKNYIHVTLIEANEILSSFDDRLRHYATKQLTKSG
VRLVRGIVKDVKAQKIILNDGTEVPYGLLVWSTGVGPSPLVNSLPLPKAPGGRVGVDEWL
QVPSVQDVYSIGDCSGFVESTGKPTLPALAQVAERQGKYLANLLNKIGKAGGGRANGAKE
YKYEDPFVYKHLGSMATLGRYKALVDLRQSKDGKGLALAGFTSWFIWRSAYLTRVLSWRN
RFYVAINWATTFVFGRDITRI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcttggttcagaagcctcatccaagtctcagccaccgccagatcagcgaccaaaccc
agaatttcagacccattttcttacactctgctctcgcgcttcagctcggagccggctccg
atccatgagactccggctcctcagccgccgacccagtactcgggtctgggccccacgaag
cctggcgagaagccccgggtggtggtcttgggcacgggttgggccgggtgccggctcatg
aaaggcttggacaccgatatatacgacgtcgtttgcgtgtcgcctaggaaccatatggtc
ttcacgcctctgttggcgtccacctgcgttgggactctggagtttaggtccgtcgcggag
ccaatcgggaggatccaacccgcaatatctcgcgaacccgggtcgtatttctttctttct
aattgtgttggcctcgatcctgataagcatttggtgcaatgcgagactgtaactgatgga
gcagaacccttgaagccatggaaatttgaaatttcatacgacaagttggtaattgcattg
ggagcaaagccaaccacttttggaatacagggtgtagaagaacatgcaatttttcttcgt
gaagtctaccatgcccaggaaatccgcaggaagctgctcctaaacttgatgctgtcggat
gttcctggtgtttctgaggaagagaaaagcagactcctacactgtgttgttgtaggaggt
ggtcccacgggagttgagtttagtggtgaactgagtgacttcattcagagagatgttcga
caaagatattcccatgtgaaaaattatattcatgttaccttgattgaggcaaatgaaata
ttatcatcatttgatgatcgattgcggcactatgctacaaaacagctgacaaagtcagga
gttcgtcttgtccgtgggatcgtcaaggatgtcaaagctcagaagataattcttaatgat
ggcaccgaggttccttatgggctgctggtatggtctactggtgttggtccatcacctttg
gtgaactccttgccacttccaaaagctcctggtggaagggttggcgttgacgagtggctg
caggttccttccgtccaggatgtgtattcaattggtgattgtagcggttttgttgaaagt
actggaaaaccaacccttccagccttggcccaggttgcagagaggcaaggaaagtatctg
gcgaatttgttgaacaaaattggtaaagctggtggaggacgtgccaacggtgcaaaagaa
tataaatatgaggatccatttgtgtacaagcatttaggaagcatggcaactcttgggaga
tacaaggctcttgtcgacctcagacagagcaaggacggaaaaggcttagctctggctgga
ttcaccagttggtttatatggcgctcggcatatttaacacgagtcttgagctggaggaat
agattctatgtggcgattaactgggctacaacttttgtgttcgggcgtgatataaccaga
atctag

DBGET integrated database retrieval system