KEGG   Prunus persica (peach): 18776968Help
Entry
18776968          CDS       T03092                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 27
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
pper  Prunus persica (peach)
Brite
KEGG Orthology (KO) [BR:pper00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pper03041]
    18776968
   03009 Ribosome biogenesis [BR:pper03009]
    18776968
Enzymes [BR:pper01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     18776968
Spliceosome [BR:pper03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    18776968
Ribosome biogenesis [BR:pper03009]
 Eukaryotic type
  90S particles
   Helicases
    18776968
  Pre-60S particles
    18776968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 PAG
Motif
Other DBs
NCBI-GeneID: 18776968
NCBI-ProteinID: XP_007210871
UniProt: M5WZ28
Position
G5
AA seq 594 aa AA seqDB search
MTDAIPYASPDDETKKKKRKRNRGKKQSESADTEQAEPQNPIPAKQEEEEEIEKEEKGEV
EKQAKDEEKKTKKRKSSKGEEAEAKIPSEKKVKSDGASGIMSTQSFSSLNLSENTFKAIQ
EMNFQYMTQIQARAIPPLLIGQDVLGAARTGSGKTLAFLIPAVELLYNTHFAPRNGTGVV
VICPTRELAIQTHAVAKDLLKYHSQTLGLVIGGSARRGEAERIVKGVNLLVATPGRLLDH
LQNTKGFIYKNLKCLMIDEADRLLEANFEEEMKQIIKYLPKDRQTALFSATQTKKVEDLV
KLSFRKDQKPIYVDVDEGRSKVTNEGLQQGYCIVPSAKRFLLLYSFLTKNLSKKVMVFFS
SCNSVKFHSELLKYVNVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPA
VDWILQFDPPDEPKEYIHRVGRTARGEGGKGKALLFLIPEELQFIRYLKAAKVPVKEHVF
NEKQLKNVQSQLEKMVEGNYYLRKSAKEAYTSYLLSYNSHSMKDIFNVHRLDLQAVAASF
CFSNPPKVNLNLDSSASKFRKKMRKVEGSRNGFSESNPYGRQKGGDDKRQFVRH
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgcaattccttacgcatctccggacgacgagacgaagaagaagaagcgcaag
agaaacagagggaagaaacaatcagaatcggcagacaccgaacaagcagagcctcaaaac
cctattccggcaaaacaagaagaagaagaagaaatagaaaaagaagaaaaaggagaagtt
gagaaacaagctaaggatgaagagaagaagaccaagaagaggaagagttcgaagggagag
gaagcagaggctaaaatccctagcgagaagaaggtgaagagtgatggagcgtctgggatt
atgagcacacagtccttttcttccttgaatttgtctgagaacactttcaaggccattcaa
gaaatgaactttcagtatatgactcagattcaagccagagcaatcccaccgctcttgatc
ggacaagatgtcctcggagctgcaaggacaggatctgggaaaactcttgcttttctaata
ccagctgtggagctgctatataacacacattttgctcctcgtaatggaacaggtgttgtt
gtgatttgcccaacacgggaacttgcaatacagacccatgccgtggcaaaggaccttcta
aagtatcactcacagaccctgggcttggttatcggaggttcagccaggagaggagaagca
gaacgtattgtaaaaggagtaaatttattggttgcaacccctggtcgacttcttgaccat
cttcagaataccaagggattcatatataagaacttgaagtgcctcatgattgatgaagct
gacaggttattggaagcaaactttgaggaagaaatgaaacagattattaagtatctaccg
aaggataggcaaacagctttattttcagcaacccaaactaagaaggttgaagatcttgtt
aagttgtcgtttcggaaagatcagaaacctatctatgttgatgtggatgaggggagaagt
aaggtcaccaatgaagggctgcagcaaggttattgtattgtgcctagtgccaagagattt
cttcttctatattctttcctgacgaagaatctttctaagaaagtgatggtcttcttctct
tcttgtaactccgtcaaattccactccgaactgcttaaatacgttaacgtggattgcttt
gatatccatggaaagcaaaagcagcagaagaggacaactactttttttgatttctgcaaa
gcagagaaaggaatcttactttgtaccgatgttgctgctcgtggactggatattcctgct
gtggactggattttgcagtttgatcctccggatgaacccaaggaatatatccacagggtt
ggtcgaacagctcgaggggaaggtggaaaaggaaaggcactacttttcctcattcctgaa
gagttgcaatttatacgctatttgaaggctgcaaaagtccctgttaaagagcatgtattt
aatgagaagcagctgaaaaatgtgcagtcacagctggagaaaatggttgaaggcaactac
tatctgcgcaaatcagcaaaagaggcgtatacatcttatttattatcatataattcacac
tccatgaaggacatctttaatgttcaccgccttgatctgcaggcggttgcagcttccttt
tgcttttctaatccacccaaggtgaatttgaacttagacagcagtgcatcaaagttcagg
aagaagatgcgtaaagtagagggaagtcgaaatggattcagtgagagcaatccttatggt
agacaaaaaggtggtgatgacaaacgacaatttgtaaggcattag

DBGET integrated database retrieval system