KEGG   Prunus persica (peach): 18779209Help
Entry
18779209          CDS       T03092                                 

Definition
(RefSeq) (-)-alpha-pinene synthase
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
pper  Prunus persica (peach)
Pathway
pper00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    18779209
Enzymes [BR:pper01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     18779209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth TPR_1
Motif
Other DBs
NCBI-GeneID: 18779209
NCBI-ProteinID: XP_020418132
Position
G4
AA seq 563 aa AA seqDB search
MSKEAGSASQSKNPKPDQIVRRTANYQPSIWGDQFINYDSEDIINYAHKQEEVDELKLVV
RREVFTTSGDDFSNQMKLIDAIQRLGVAYRFEKEIEEALEHIYAANHFHDDDGDGDLYDV
SLGFRLLRQHGHYVSCRIFNKFKDSKNGGFKESLIADVPGMLSFYEATHLRVHGEDILEE
AIVFTTKHLESATTHVSYELAEQIAQALERPLRKSLERLCARQFMSIYQDEASHNEALLK
LAKSDFNLVQSLHKQELSEIIRWWKQLDFGRKLPFARNRIVELYCWVLGVYFEPQYLFGR
KFLTKIIALLCVMDDIYDAFGTFEELEIFTEAIHQRWHANCMDGLRDYMQIFFHALLNVF
NEIEEEMVKEGRAYRAHYAKEAWKTNAKAYFDEAKWFHEGCIPSMEEYMRVATASAGHTT
LTTMSLLGMGDIVTKESFEWLLNDPKILRASNIIGRLMDDIVSSKFEKERGHVASAIDCY
RKQYEVSDEQEIIDAFNKQIVDSWKDINEEFLRPTSVPMPILVRVLNLTRVADLIYKKDD
GLTHVGKVMKDSVASYFIDPAPP
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagaagctggttcagcatctcaatcaaaaaatcctaagcctgatcaaattgtt
cgacggacagcaaactaccaaccgagcatttggggggatcagtttatcaattatgattct
gaagacattataaattatgcccataagcaagaagaagttgatgaactgaaactagtagtg
aggagggaagtgttcacaaccagtggagatgatttttcgaatcagatgaagctaattgat
gcaatccagcggctcggcgtggcgtaccgctttgaaaaggaaatagaagaagcactggaa
catatatatgctgcaaatcatttccatgatgatgatggtgatggtgacctatacgatgtt
tcccttggttttcggctactaagacaacatggacattatgtttcatgcagaatattcaac
aagttcaaagatagtaaaaatggaggcttcaaggaaagcttaatcgctgatgtgccagga
atgctaagcttttatgaagcaacgcatctgagggtgcatggagaagatatactagaagag
gctattgttttcaccacaaaacatctggagtcagcaacaacccatgtaagctatgaactg
gcagaacaaatagctcaagccctagagagaccgctccgaaagagtctcgagaggttatgt
gcccgtcagttcatgtccatctaccaagatgaagcttcacataatgaagctctattaaaa
cttgccaagtcagatttcaatcttgttcagtctttgcacaaacaggagctcagtgagatt
attaggtggtggaaacaactagactttggaaggaagctgccttttgcaagaaacagaatt
gtggagttatactgctgggttttgggggtctattttgagccccaatacctttttggaaga
aaatttctcacaaaaattattgccctgctttgtgtaatggatgatatctatgacgcattc
ggtacatttgaagaacttgagatctttaccgaagcaattcatcaaagatggcatgccaat
tgcatggatggactgcgagactacatgcaaatattcttccatgcacttttgaatgttttc
aatgaaattgaggaggagatggtgaaggaaggaagagcataccgagctcactatgcaaaa
gaagcttggaaaactaatgccaaagcttactttgatgaggccaaatggttccacgaagga
tgcatccccagcatggaggaatatatgcgtgttgctacagcatctgctgggcacaccaca
cttacaactatgtctttacttggcatgggagacattgtaaccaaggagtcctttgagtgg
ttgttgaatgaccctaaaattcttagagcttccaatatcattggtaggctcatggatgac
attgtttcgagcaagtttgagaaagagagagggcatgttgcttctgccattgattgttac
aggaagcaatatgaggtgtcagatgagcaggaaataattgatgccttcaacaaacagatt
gtggattcgtggaaagatatcaacgaggagttcctcagaccaacctctgtgccaatgcct
atccttgtacgtgttcttaatttaacaagagtggcggatctcatctacaaaaaagatgat
ggcctcacacatgttggaaaagtcatgaaagatagtgttgcttcttatttcattgatccg
gcaccaccatga

DBGET integrated database retrieval system