KEGG   Prunus persica (peach): 18779303Help
Entry
18779303          CDS       T03092                                 

Definition
(RefSeq) beta-glucosidase 24 isoform X1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
pper  Prunus persica (peach)
Pathway
pper00460  Cyanoamino acid metabolism
pper00500  Starch and sucrose metabolism
pper00940  Phenylpropanoid biosynthesis
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    18779303
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    18779303
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    18779303
Enzymes [BR:pper01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     18779303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 18779303
NCBI-ProteinID: XP_007214757
UniProt: M5WRV8
Position
G4
AA seq 529 aa AA seqDB search
MNQDHHNTNKRLVMEKQLRSLMLGVGELLLLVCFALLTNNKAVALLNRSSFPPGFIFGSG
SGSYQYEGAANEGGRGPSIWDSYTHKHPERIMDGSNGDVALDEYHKYKEDVEIMKDIGLD
AYRFSISWPRLLPSGKLNDGVNEVGIRYYNNLINELLRNGIKPFVTLFHWDLPQALEDEY
GGLLSDQIVNHFRDYAELCYKEFGDRVKYWTTLNEPYTYSINGYASGSYAPGRCSNWQKL
NCTGGNSAIEPYLVTHHLLLAHAAAANLYKNKFQAYQKGVIGITLVSPWFVPLSEANEDK
KAALRALEFTFGWFMEPLTCGDYPNNMRSIVGTRLPKFTKAQSKTLIGSFDFLGLNYYTS
YYASDASNNVYEHASYLTDVGVTLSSERNGIPIGAKGASSWLNVYPIGIQNLLLYTKEKY
NDPIIYITENGIDEFNDPKLSLEEALYDTQRVDYHILHLYHVQTAIKNGVNVKGYFLWSL
LDNFEWNEGFTVRFGTNYVDYNNGLKRLPKLSTRWFKSFLGSNEEAYYS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagatcaccacaacacaaacaaacgcctagtgatggaaaaacaattaaggtct
ttgatgttaggtgtgggggagctgctgctgctggtttgctttgcattattgacgaataac
aaagctgttgctctcctcaacaggagcagttttcctccaggtttcatatttggctcaggt
tcaggatcttaccagtatgaaggcgctgcaaatgaaggtggtcgaggaccaagcatctgg
gattcttacacccacaaacatccagaaaggatcatggatggcagcaatggagatgttgct
ctggatgaatatcacaagtataaggaagatgtggaaattatgaaggatataggcttggat
gcttataggttttctatttcatggcccagattattaccaagtggaaagttaaatgatggt
gtgaatgaggttggaatcagatactacaacaatctaatcaatgaacttctcagaaatggt
ataaagccatttgtcacactttttcattgggatcttcctcaagctttggaagacgaatat
ggtggtcttttaagcgatcaaattgtcaatcattttcgagactatgcagaactttgttat
aaggaatttggtgatcgagtaaagtactggaccacattgaatgagccatatacctatagt
atcaatggttatgcttctgggtcttatgcaccaggacgatgttctaattggcagaaatta
aattgcactggtggaaattcggctattgaaccatatttggtgactcaccaccttctactt
gctcatgctgctgctgcaaacttgtataagaataaatttcaggcatatcaaaaaggtgtg
ataggaataacgctcgtgtcaccatggtttgtgcctctttcagaggcaaatgaagataaa
aaggctgcattacgagcattggagtttacttttggatggtttatggaaccattgacatgt
ggtgattatccgaacaacatgcgatctattgttggaacgcgcttaccaaaattcacaaaa
gcacaatccaagacgctaattgggtcatttgattttcttggactaaattactacactagt
tactatgcaagcgatgcatctaataatgtttatgaacatgcaagctacttaacagatgtt
ggagtgactctttcatctgagcggaatgggattcccattggtgcaaagggtgcttcaagc
tggctaaatgtttatccaataggaattcaaaatttgttactgtacacgaaggaaaagtat
aatgatccaatcatttacattactgagaatggcattgatgaatttaatgatccaaagtta
tcgcttgaggaagctctttatgatacccaaagagttgactatcacattcttcacctctat
cacgttcaaactgcaatcaaaaatggtgtcaacgtgaagggatactttctatggtcatta
ctagacaactttgaatggaacgagggattcactgttcgatttggtaccaattatgtggat
tacaataatgggctgaaaagactaccaaaactctcaactcggtggttcaaaagtttccta
ggaagtaatgaagaagcttattattcataa

DBGET integrated database retrieval system