KEGG   Prunus persica (peach): 18779554Help
Entry
18779554          CDS       T03092                                 

Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pper  Prunus persica (peach)
Pathway
pper00600  Sphingolipid metabolism
pper01100  Metabolic pathways
Module
pper_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    18779554
Enzymes [BR:pper01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     18779554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat THF_DHG_CYH
Motif
Other DBs
NCBI-GeneID: 18779554
NCBI-ProteinID: XP_007211993
UniProt: M5WHA1
Position
G4
AA seq 491 aa AA seqDB search
MDRPESAQPILSDRVLINGTVTPVTLFADGVLRWSERGQRSLIVEKEVLGFAAEGPKIRI
RALVEDGDGICCVASRGAVVRKEFVFKPLSEDSHRLWCQKLREHIDSLGRPKRLFVFVNP
FGGSKSASKIYAEHVKPLFQDANIQFTLQETQYQLHAKEVAKTLDLSKYDGIVCVSGDGI
LVEVVNGLLEREDWEAAIKMPLGVVPAGTGNGMAKSLLDSVGEPCTASNAILAIIRGNKR
SLDVATIWQGKTKFFSVLMLAWGLVADVDIESEKYRWMGSARLDFYAVQRIVHLRQYNGS
ISFVPAPGFEIYGEPTSYNNISEPTNHHNKCGPSQEEPVNIRQHGYEGPDINLENMDWRT
INGPFVSVWLHNVPWGSEDTKAAPDAKFSDGYLDVIIMRACPKLSLLSLMSGLSTGSHVN
SPYVMYFKVKALILEPGPLTEDPTKGGIIDSDGEVLARGKGAYKCDQKTLMAYDKLQITV
DQGLATLFSPV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaccgacccgagtccgctcaacccatactctccgaccgggtcctcataaacggcacc
gtcactccggtgactctattcgccgatggagttctccggtggtcggagagaggtcaacga
agcttgatcgtggagaaggaggtcctcgggttcgcagcggaaggtccgaagattaggatc
agagccttagtggaagacggagatggaatctgctgcgtcgcgagcagaggagctgtggtg
aggaaagaattcgtcttcaagcctctctctgaggactcgcataggctctggtgccagaag
ctccgcgaacacattgattctctggggcggccaaagaggctcttcgtttttgtgaatcca
tttggtgggagcaaatccgcttcaaaaatatatgctgaacacgtaaaacctcttttccag
gatgctaatatccaatttacactacaagaaactcaatatcaactacatgcgaaggaagtt
gctaaaacactagatctttcaaagtatgatggcattgtttgtgttagtggggatggaatc
ttggttgaggtagtaaatggactccttgagagagaggattgggaagctgcaataaagatg
cctcttggagtagttcctgcaggtacaggaaatggaatggcaaaatctcttttggattct
gttggtgaaccttgtacagcatctaatgctattcttgccattattcgagggaataagcgt
tcactggatgtagctaccatatggcaggggaagaccaaattcttcagtgtattgatgctt
gcatggggtttagtggcagatgttgacattgagtctgagaagtataggtggatgggaagt
gctcgtctagatttctatgctgttcaacgaattgtgcatttgaggcaatataatggatct
atttcctttgtgcctgcacctggctttgaaatttatggggagcctactagttacaacaac
attagtgaacctactaaccatcacaataaatgtggtccaagtcaagaggagcctgttaac
attcgacagcatggctatgagggacctgatattaacttggagaacatggactggagaact
attaatggaccattcgtttcagtctggcttcacaatgtcccttggggaagtgaagacaca
aaggcagcgcctgatgccaagttctcagatggttacctagatgtgataattatgagagct
tgcccaaaactatccttgctctcgttgatgtcagggttgagcacaggaagtcatgtcaat
tcaccatatgtcatgtacttcaaggtgaaagcattaattttggaaccaggtcctctcact
gaggaccccacaaagggagggattatagactcagatggtgaggtcctggctaggggcaaa
ggagcatacaaatgtgaccaaaagacgctgatggcctatgataaactccaaataactgtg
gatcaaggtttagctactctgttttccccggtataa

DBGET integrated database retrieval system