KEGG   Prunus persica (peach): 18779803Help
Entry
18779803          CDS       T03092                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pper  Prunus persica (peach)
Pathway
pper00350  Tyrosine metabolism
pper00360  Phenylalanine metabolism
pper00380  Tryptophan metabolism
pper00950  Isoquinoline alkaloid biosynthesis
pper00965  Betalain biosynthesis
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    18779803
   00360 Phenylalanine metabolism
    18779803
   00380 Tryptophan metabolism
    18779803
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    18779803
   00950 Isoquinoline alkaloid biosynthesis
    18779803
   00965 Betalain biosynthesis
    18779803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pper04147]
    18779803
Enzymes [BR:pper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     18779803
    4.1.1.105  L-tryptophan decarboxylase
     18779803
Exosome [BR:pper04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18779803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC DUF1148
Motif
Other DBs
NCBI-GeneID: 18779803
NCBI-ProteinID: XP_020418863
Position
G4
AA seq 533 aa AA seqDB search
MMGSVEFEHPQENNSAHMTTSPLDPEEFRRQGHMVIDFIADYYKTIEKYPVLSQVQPGYL
KKRLPESAPYDPEPIETILQDVQDHLVPGLTHWLSPNHFGYFPAAISTAAFLGEMLTTGF
NVVGFNWMASPAATELENIVMDWLGDMLKLPKSFLFSGNGGGVLQGTTCEAIVCTMAAAR
DQMLRQIGRENIGKLVVYGSDQTHSALQKASQIVGIHPKNFRAIETTTSTSFALSPEVLK
STICSDIEAGLVPLFLCATVGTTAITAVDPLGPLCEVAKEHDMWVHVDAAYAGSAFICPE
FQYFIDGVEGADSFSLNAHKWFFTTLDCCCLWVKNPSALVSSLSTNPEFLRNKATDSKQV
VDYKDWQIALSRRFKAIKLWLVLRSYGVGNLRNFLRSHVKMAKIFEGLVGMDKRFEIVAP
RHFSLVCFRVSPSAISKANPSLSDHDNGKLKAHNYELLNGVKCVVNEVNSKLLEAINGSG
LVYMSHAVVGGMYVLRCAIGASLTEEKHVAMAWKVVQEHADAILGTKIIVDQT
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtagcgtcgaattcgagcatccacaagaaaacaattctgcccacatgaccact
agccctctagaccctgaggaattcagaaggcaaggccacatggtcatagacttcattgca
gattattacaaaacaattgaaaaatacccagttcttagccaagtccaaccgggctatctc
aaaaaacgcttgccagaatctgccccatacgaccctgaacccattgaaaccatcctccaa
gatgtgcaggatcaccttgtccctggcctaacacattggctaagccctaaccactttggc
tacttccctgcagctatcagcaccgcagcgttcctcggcgaaatgctcaccactggtttc
aatgttgtggggttcaattggatggcatccccagctgcaactgagcttgaaaacattgtc
atggattggcttggagatatgctcaaacttcccaagtctttccttttctctggcaacggc
ggaggtgtattgcaaggcactacttgtgaggccattgtttgtaccatggcagccgccagg
gatcaaatgctaaggcaaattggtagagagaatattgggaagctagttgtgtatggatca
gaccaaacacacagcgcgcttcaaaaagcttctcaaattgttgggattcacccaaagaat
ttcagggccatagagaccacaacatcaacatcatttgcactatcacctgaggtgctaaaa
tcgactatttgttcagacatagaagctgggcttgtcccattgtttctatgtgccacagtg
ggaacaaccgcaataacagccgttgatccattggggccactctgcgaggtggcaaaagaa
catgacatgtgggttcatgtggacgctgcatatgctggaagtgctttcatttgtccagag
tttcaatactttatcgatggcgttgagggtgcagattcattcagtctcaatgcacacaaa
tggttcttcacaaccctcgactgttgttgcctctgggttaagaatccaagtgctttggtg
agctcactttcgacgaatccggagtttctgaggaacaaggccacggattcgaagcaagtg
gtggactacaaggactggcaaatagccttgagcaggaggttcaaggccatcaaattatgg
cttgtgcttagaagctatggtgtgggcaaccttaggaactttcttaggagccatgtgaaa
atggccaagatttttgaagggctagtggggatggacaaaaggtttgagattgtggcccct
aggcatttctctttggtctgttttagggtttctccatcagcaattagcaaggctaatcca
agcctaagtgatcatgataatggtaagcttaaggcacataattatgaattgttaaatggt
gtaaaatgtgtagttaacgaggtgaatagcaagttgctggaggcgattaacgggtcgggt
ctggtgtacatgagccatgctgtggttggagggatgtatgtgttacgttgcgccattgga
gcaagtctcactgaggaaaagcacgtagccatggcttggaaggtggtgcaagagcatgca
gatgcgatccttggaactaagattattgtggatcaaacttag

DBGET integrated database retrieval system