KEGG   Prunus persica (peach): 18780113Help
Entry
18780113          CDS       T03092                                 

Definition
(RefSeq) probable pyruvate, phosphate dikinase regulatory protein, chloroplastic
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
pper  Prunus persica (peach)
Brite
KEGG Orthology (KO) [BR:pper00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    18780113
Enzymes [BR:pper01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     18780113
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     18780113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase AAA_18
Motif
Other DBs
NCBI-GeneID: 18780113
NCBI-ProteinID: XP_007213991
UniProt: M5X7X5
Position
G4
AA seq 400 aa AA seqDB search
MIASSTLSVPNLGLAPRTSYANHQPILKTPNASASSSEPQGGKPKGSSQLTRWSRARAIR
SGRKLDRAGQRSQLLEPNSPVQPRERVSLDVKDDTSTGSDGEDDVEMTAGKSIYMVSDGT
GWTVEHSVNAALGQFEHCLVDRGCAVNTHLFSGIDEVERLMEIVKQAAKEGAMLVYTLAE
PSMAESARHACKHWGIPTTDMLGPITEAIATHLGVSPSGLPRGAPGRSFPLTDDYFRRIE
AIEFTIKQDDGALPQNLHKADIILAGVSRTGKTPLSIYLAQKGYKVANVPIVMGVPLPKT
LFEVDPEKVFGLTINPLVLQTIRRARAKTLGFSEGMKSNYSEMDHVRQELEFARTILAQN
PVWPVIEVTGKAIEETAAVVLRLYHDRKHKCSMPRISKRY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttcttccaccttgagcgttccgaatctcggtctcgcacccaggaccagttat
gcaaatcaccaaccaatactcaaaactccaaacgcctccgcttcctcctccgagccgcag
ggtggaaaacccaagggtagctctcaactgactcgatggtccagggcgcgggccatacgc
tcgggtcggaaattggaccgcgcgggccagcggagccagttgctggaaccgaattctccg
gtgcagccgagagagcgcgtctcgctagacgtcaaggatgatacttcaacaggaagcgac
ggcgaggatgacgtggagatgacggcggggaagtcgatatacatggtttctgacggaact
gggtggacggtcgagcactccgtgaacgcggcgttgggccagttcgagcattgcttggtc
gatcggggctgcgctgtcaatacccatttgttttctgggattgatgaagtagagcggtta
atggagattgtaaagcaagcagccaaagaaggtgccatgcttgtgtacacattagctgaa
ccatcaatggctgagtctgctaggcatgcctgtaagcattggggcataccaaccacagat
atgttgggtccaattacagaggccatagcaacccatctaggcgtgtcaccctctggcctt
ccacgtggggctcctggcaggagctttcctcttacagatgactactttcgtaggattgaa
gccattgaattcactatcaagcaagatgatggggcattgccccagaacttgcacaaggct
gacattatacttgctggggtctctcgtactgggaagaccccgctgtcgatttatctggcg
cagaaaggttacaaagtggcaaatgtgcctattgtgatgggggttccattgccaaagacc
ctttttgaggttgacccagaaaaggtttttggtctcactatcaatcctctagtgttgcaa
acaattagaagggcaagagctaagactctgggatttagtgaaggaatgaagagtaactat
tccgagatggatcatgtgagacaggagctggaatttgctcgaacgattcttgcacagaat
cctgtctggccagtaattgaggtaacaggcaaagcaattgaagaaactgctgctgttgta
ctgaggctttatcatgaccggaagcacaagtgctcaatgccaagaatatcaaaacgttat
taa

DBGET integrated database retrieval system