KEGG   Prunus persica (peach): 18781019Help
Entry
18781019          CDS       T03092                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pper  Prunus persica (peach)
Pathway
pper03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pper00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    18781019
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pper03041]
    18781019
Enzymes [BR:pper01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     18781019
Spliceosome [BR:pper03041]
 Complex C
  Other components
   Step II factors
    18781019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 ABC_tran T2SSE Sigma54_activ_2 PhoH
Motif
Other DBs
NCBI-GeneID: 18781019
NCBI-ProteinID: XP_020412191
Position
G2
AA seq 1195 aa AA seqDB search
MAATDDGLKKLEYLSLVSKVCSELETHIGVGDKVLAEFITELGRKCETVDEFDTKLKKNG
AEMPDYFVRTLLTIIHAILPPKPKPEKDSKKESASDGRKTKFKALAVADNKDRVKDIEKE
IEMETKEKRNRREEQDEEREEDRRRGSDRYREGDRDRDRDRHRGGRDRDGRERRRERYDR
DERRRDTHYNDDDDDRGRHTDRYNKHKRDRYEDDGDVKEDGDDRRGNRDRQNGQNHSDEP
ELYQVYKGRVSRVMDTGCFVQLNDLRGKEGLVHVSQMATRRISNAKDVVKRDQEVYVKVI
SISGQKLSLSMRDVDQHTGKDLLPLKKSSEDDALRTNPSFSKDGPVTRTGLSGIRIVEED
DVGPSRRPLKRMSSPEKWEAKQLIASGVLGVTEYPMYDEETDGMLYQEEGAEEELEIELN
EDEPAFLNGQSRYSVDMSPVKIFKNPEGSLGRAAALQSALIKERREVREQQQRTMLDSIP
KDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKTISFGQRSKLSIQEQRQ
SLPIYKLKKELIAAVHENQVLVVIGETGSGKTTQVTQYLAEAGYTTMGKIGCTQPRRVAA
MSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVVM
LDEAHERTIHTDVLFGLLKKLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFP
VEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKN
VPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQN
VYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRI
NLGTTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEF
PLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHL
TLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTKI
RKAITAGFFFHGARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMR
EVTVVDPKWLVELAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atggctgccactgacgatggtttgaagaagctcgagtacctttccttggtttccaaggtc
tgttcagagctcgaaacccatataggggttggggacaaagttctggcggagttcatcact
gagttgggacgaaagtgcgagacggtggacgagtttgacaccaaattaaagaaaaacggt
gccgagatgcccgattactttgtccgtacactcctcactatcattcacgctattcttcca
ccaaagccaaagcctgagaaggactcgaagaaagagagcgcttctgatggtaggaagacc
aagtttaaggctttggcagtcgctgataataaagatagagtcaaggacatcgagaaggaa
attgagatggagaccaaggaaaagcgaaacagaagagaagaacaagatgaagagcgagaa
gaagataggcgtagaggtagtgatagatatagggaaggagatagagatagagatcgagat
agacacagaggaggtagagatagagatgggagggagaggcgaagggaaaggtatgataga
gatgagaggcgcagagatacacattataatgatgatgatgatgacaggggaaggcataca
gatcgatacaataagcataagagagataggtatgaagacgatggagatgttaaggaagat
ggtgatgataggagaggtaatagggatcggcagaacggccagaaccattcggatgagccc
gaattgtatcaggtttataagggcagggtttcgagagtgatggacaccggttgttttgtt
cagttgaatgatttaagagggaaggagggtctggttcacgtttcacagatggcaactagg
cgaattagcaatgctaaggatgtggtgaagagggatcaggaagtttatgtgaaggtgatt
tcaatttcaggtcagaagttgagcctttcaatgagggatgttgatcaacatacagggaag
gatttgctccccttgaagaagagctcagaggatgatgctcttaggacgaacccatctttt
tcaaaggatggacctgtgactaggactggtctttctgggattaggattgtggaagaggat
gatgttggcccatcacgtcggccattgaagagaatgagctcgccagagaagtgggaagcc
aaacagttgattgcctcaggtgttttgggtgttacagagtatcctatgtatgatgaggaa
accgatgggatgctttatcaagaagagggagctgaggaagagcttgagattgagctcaat
gaggacgagccagcctttttaaatggacagagcaggtattctgttgatatgtcacctgtg
aaaatctttaagaatccagaagggtcactgggtcgtgcagctgcacttcagtccgcactc
attaaggagcgtagagaagtgcgtgagcagcagcagagaaccatgttggattctatccca
aaggatctcaatcgtccctgggaagatccaatgccagagactggtgagaggcatcttgca
caagaacttagaggtgttggtttgtcagcatatgatatgcctgagtggaagaaggatgct
tttgggaaaactatcagttttgggcagaggtcaaaactctcaatccaggaacagaggcag
agcttgcctatctacaagctgaagaaagaattgattgcagcggtgcatgagaaccaagtg
cttgtcgtcattggtgagactggttcgggtaagacaacacaggtaacgcagtatcttgca
gaagcgggttacacgacaatgggtaagattggttgtacacagccacgtagggtggctgct
atgtctgtggccaagagggttgctgaagagtttggttgtcgtttaggagaggaagtcggc
tatgcaattcgttttgaggattgcactggtccagacactgtcatcaagtacatgactgat
ggtatgcttcttagggagattttgattgatgagaacctttctcagtattctgtggtcatg
cttgatgaagctcatgagaggacaatccacacagatgttctttttggactactgaagaag
cttgtgaagcggagaccagaccttcgtttgattgtcacatctgctaccttggatgcggag
aagttttccggttatttctttaactgtaacatcttcactatccctgggagaacttttcct
gtagagatactctacactaaacagccggaaagcgactaccttgatgcatctctaataact
gttctacaaatacacttgacagaacctgaaggtgacatccttcttttcttgactggacaa
gaagagattgattttgcatgccagtctctttatgagaggatgaaaggtcttggtaaaaat
gtccctgagttgattatcctaccagtgtatagtgcccttcctagtgaaatgcagtcaagg
atatttgatcctgccccaccaggtaagaggaaagtagttgtggctactaatattgctgag
gcatcactgaccattgatgggatattttatgtcattgatcctggttttgcaaagcaaaat
gtttataacccaaagcaggggctagattcactggtcataactccaatttcccaagcatca
gctaagcaacgagctgggcgtgctgggcgtacaggccctgggaaatgttaccgcctctac
actgagagtgcataccgcaatgagatgtcccctacttcaattccagaaatccagaggata
aatcttgggactactacacttacgatgaaagctatggggataaatgatctcttgtctttt
gattttatggatcctccttcaccccaagcactcatttctgccatggaacaattgtacagt
ttaggagcactggatgaggaggggctgctcaccaaattgggtaggaaaatggctgagttt
cctctggatccacccttgtctaagatgctactggccagtgtggaccttggatgcagtgat
gagatcttgaccatcattgcaatgattcagactggtaatattttttacaggcctagggaa
aaacaagcccaggcagatcagaagagagccaagtttttccagccagagggagatcatctg
actttacttgcagtctatgaggcatggaaagctaagaatttttcagggccatggtgtttt
gagaattttgttcagtctcgatccttgaggagggcacaggatgtcagaaaacagcttctc
agcatcatggacaagtataaactagatgttgtcagtgctggaaagaattttacaaagatc
aggaaggcaattacagcagggtttttcttccacggtgctagaaaggacccgcaggagggt
tatagaaccctagtggagaaccaaccagtttatatacacccaagcagcgccctcttccag
agacaaccagattgggtgatctaccatgagctggttatgaccacaaaggagtacatgcgc
gaggtgacggttgtcgaccccaaatggcttgtggaactggcacccaggttcttcaaagtg
gcagatcccaccaagatgagcaagcgcaagcgtcaagaacgtattgaaccgctatatgat
agataccatgaacctaactcttggcgtcttagtaagcgacgtgcttga

DBGET integrated database retrieval system