KEGG   Prunus persica (peach): 18782201Help
Entry
18782201          CDS       T03092                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pper  Prunus persica (peach)
Pathway
pper00052  Galactose metabolism
pper00500  Starch and sucrose metabolism
pper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    18782201
   00500 Starch and sucrose metabolism
    18782201
Enzymes [BR:pper01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     18782201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 18782201
NCBI-ProteinID: XP_020416396
Position
G3
AA seq 598 aa AA seqDB search
MGKDAPINTQQSVALFCHSCKAIMAISSFYLYCFLSLWLGQALLLQASHHVYRNLQTSLV
ADSHHQVKEPYRTGYHFQPPKNWINDPNGPLIFKGIYHLFYQYNPEGVVWGNIVWAHSTS
TDLVNWTPHDAAIYPSQPSDINGCWSGSATILPGGKPVILYTGINPQNEQVQNLAYPKNL
SDPYLREWTKVPQNPLMAPTQANQINASSFRDPTTAWLGPDKRWRVIIGSKRDQTGFAIL
YRSKDFLNWVKAKHPLHSAKKTGMWECPDFYPVSIKGQNGLHTSENGPDVKHVLKASLDN
TKREYYTIGTYNIHKDIYIPDKGSVESDAGLRYDYGKFYASKTFFDSSKNRRILWGWINE
SSSVEDDTKKGWSGIQAIPRKIWLDKSGKQLVQWPVAEIEKLREKEVKLPSSALKGGSVH
EVLGVTAAQADVDITFEISDFKKAEVLDPSWTDPQLLCSQKGASVKGGLGPFGLLVLASK
GLKEYTAVFYRIFKGHNNKYVVLLCSDQSRSSLNQDNDKTTYGAFLKVDPLHEKLSLRSL
IDHSIVESFAGQGKACITARVYPTLAIDVDAHLYAFNYGTEDVKITGSAWSLKTAEIN
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggatgctcctataaatacccagcagagtgttgccttattttgtcactcctgc
aaagccatcatggccatctcctctttctatctctactgttttctctctctttggctaggc
caggctcttctgcttcaagcttctcaccatgtttacagaaaccttcaaacttccctagta
gctgactcacaccaccaagttaaagaaccctacagaactggttaccatttccagcctccc
aagaattggatcaatgatcctaatgggccattgattttcaagggaatttaccatctattc
tatcaatacaaccccgaaggtgtagtttgggggaacattgtgtgggcccactccacatca
actgatcttgttaactggaccccacatgatgccgccatctacccatcgcagccgtcggat
atcaacggctgctggtcgggatccgccactatcctccctgggggcaaaccggtcatttta
tacaccggaataaacccccaaaacgaacaagtccagaacctggcctatcccaagaacctc
tcagacccataccttagggagtggaccaaggtcccccaaaatccactaatggcacccacc
caagccaaccaaatcaatgcaagctcatttagggacccaaccactgcttggctaggccca
gataagagatggagggtgatcattggaagcaagagggaccaaacggggtttgcaatcctg
tacaggagcaaagatttccttaactgggttaaggccaaacacccacttcactcagcaaag
aaaactggaatgtgggagtgtccagatttttacccagtctcaattaaggggcaaaatggt
cttcacacatcagaaaatggtccagatgtgaagcatgtgctcaaggctagcttggacaac
actaagcgagagtactatacaatagggacatataacattcacaaggatatctatatcccg
gataagggctcagtggagagtgacgcaggcttgagatatgattatgggaagttttatgct
tcaaaaactttcttcgacagttctaagaaccgtaggatattgtggggttggattaatgaa
tcttcaagcgtggaggatgataccaagaagggatggtctggaattcaggcaattccaagg
aaaatctggcttgataaatcgggaaaacaattggtacaatggccagtagctgaaatagaa
aagctgcgtgaaaaggaggtcaagttgccaagcagtgcgcttaagggaggatcagtgcat
gaagtacttggtgtcacagcagcacaggcagatgtagatattacttttgaaataagtgat
tttaagaaagcagaagttctagacccaagttggacagacccacaacttttgtgtagccaa
aagggtgcatcagttaaaggaggtttagggccatttgggttactagttttggcttcaaag
ggcttgaaagaatacacagcagtattctacagaatattcaaaggtcacaacaacaaatat
gtggtgctcctctgcagtgaccaaagcaggtcttccttaaatcaggataatgataagacc
acttatggggcttttctaaaggtggatcctctgcatgagaagctctcactaagaagcttg
atagatcactccatagtggagagctttgccggacaagggaaggcgtgcatcacagctaga
gtttatcccacattggccattgatgttgatgcccacttgtatgccttcaattatggaacc
gaggatgtaaaaatcacagggagtgcatggagcttgaaaacagcagaaatcaattga

DBGET integrated database retrieval system