KEGG   Prunus persica (peach): 18785898Help
Entry
18785898          CDS       T03092                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pper  Prunus persica (peach)
Pathway
pper00010  Glycolysis / Gluconeogenesis
pper00562  Inositol phosphate metabolism
pper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18785898
   00562 Inositol phosphate metabolism
    18785898
Enzymes [BR:pper01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     18785898
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     18785898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 18785898
NCBI-ProteinID: XP_020412408
Position
G2
AA seq 495 aa AA seqDB search
MKRAMAAVLLVLLTLLVHSNAEEEAFDVRHHLSTVSRYGVVKGIADSSFVPSKIPNGCTP
IHLNLVARHGTRSPTKKRIKELDNLATHLEVLLREAEEQNLSLEKLPGWLKGWKSPWKGK
LKGGELIIQGEDELYDLGIRTRARFPNLFNDDYHPDVYAIKATQVPRASASAVAFGMGLF
SGKGSLGPGRHRAFAVISESRASDTKLRFHDCCQNYKAFKKSQEPAVDKLKEPVYDEITS
ALRRRYRLNFTRQDTTSLWFLCKQEASLLNIVDQACALLSPSEVSLLEWTDDLEAFILKG
YGKSINYRMGVPLLEDVVQSMEQAIKAEEEKHAPGSYEKARLRFAHAETVIPFSCLLGLF
LDGSEFEKIQREQALPHPPKPPQKRNWRGHTVAPFGGNNMLVLYSCPANTSNKHFVRVLH
NEHPIPMPGCDGTDFCPLDVFKERIVAPHLKHDYNSMCDVKLEQQEQKPVASKLSQLFPW
MFSLGNGDKSSLDEL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggccatggcggctgttctgctagtattattaacgctactcgttcattcaaat
gccgaagaagaagctttcgatgttcgccatcacctttctactgtttccagatacggtgtc
gttaaaggcattgcggacagttcatttgttccatcgaagattccaaatggatgtactccc
atccacttaaatcttgtggcaaggcatggaactcgttctcctaccaaaaagcggattaaa
gagttggacaacttggcaactcatctggaggttttactgagagaagctgaagaacagaac
ctgtctttggaaaaacttcctggttggttaaagggttggaaatctccttggaaaggaaaa
ctgaaaggtggagaattaattatccaaggagaggatgaactctatgatcttgggatcagg
actcgagcaagatttccaaatttgtttaatgatgattaccatccagatgtttatgcaata
aaggcaacacaggtccctcgggcatcagccagtgctgtggcatttggcatgggattgttt
agtgggaaaggaagtcttggaccagggcgtcatcgagcttttgctgtaatcagtgaaagc
cgtgcaagtgatacaaagctaaggtttcatgattgttgccaaaactacaaggcatttaag
aaaagtcaggagcctgctgttgataagcttaaggaacctgtttatgatgaaataacttca
gcattaagaaggcgctacaggttgaattttacaaggcaggatacaacttctctgtggttt
ctgtgcaaacaggaagcgtccttgttgaatatagttgatcaagcttgtgcacttttaagc
ccttctgaggtttctttgctggaatggacagatgatttggaggcctttatattaaaggga
tatggtaaatcaataaactatagaatgggagtgcccttacttgaagatgttgtgcagtcc
atggagcaggctattaaggctgaagaagaaaaacatgctcctggtagttatgagaaggcg
agactaaggttcgcacatgcagaaactgtcattccattttcatgcctacttggacttttt
cttgacggatctgaatttgaaaaaatacagagggaacaggccttgccacaccctccaaag
cctccccagaagagaaattggaggggccatactgtggcaccttttggtgggaataacatg
ctggttctgtacagttgtccagccaacacatcaaacaagcactttgtgcgagtgctgcac
aatgaacatcccattccaatgccaggttgtgatggtactgatttctgtccacttgatgtg
tttaaggaaagaattgttgctcctcatttgaagcatgactataattctatgtgcgatgta
aaactagaacaacaggagcagaagcctgttgctagtaagttatctcaactgttcccttgg
atgttctcactggggaatggtgataaaagttccctcgatgaattgtag

DBGET integrated database retrieval system