KEGG   Prunus persica (peach): 18786630Help
Entry
18786630          CDS       T03092                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pper  Prunus persica (peach)
Pathway
pper00450  Selenocompound metabolism
pper00970  Aminoacyl-tRNA biosynthesis
pper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    18786630
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    18786630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pper01007]
    18786630
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pper03016]
    18786630
Enzymes [BR:pper01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     18786630
Amino acid related enzymes [BR:pper01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   18786630
Transfer RNA biogenesis [BR:pper03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    18786630
 Prokaryotic type
   Other AARSs
    18786630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 JCAD tRNA-synt_1e Viral_protease DUF3952
Motif
Other DBs
NCBI-GeneID: 18786630
NCBI-ProteinID: XP_007218925
UniProt: M5X2H9
Position
G2
AA seq 801 aa AA seqDB search
MGDLTVTSNEDQKAAKLPIPGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLR
GYNTVYICGTDEYGTATETKAIEEQCSPQEICDKYHAIHREVYQWFNISFEKFGRTSTPQ
QTEVCQAIFNKLLENDWLSENTMQQPYCDTCKRFLADRLVEGTCPTQGCDYASARGDQCE
NCGKLLNPTELKDPKCKVCKTTPRIRDTNHMFLELPLLRDKLEEYINKTSVAGSWSQNAI
QATNAWLKEGLKQRCITRDLKWGVPVPHDNFKDKVFYVWFDAPIGYVSITKCYTDDWEKW
WKNPENVELYQFMGKDNVPFHTVMFPSTLLGTGENWTLMKTISVTEYLNYEAGKFSKSKG
IGVFGNDAKDTNIPVEVWRYYLLTNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVLS
FVAKPSGQGYGSIIPDAPSADSDLLTEKLAEKVGKCVEQYIEAMEKVKLKQGLKTAMSIS
SEGNAYLQESQFWKLYKEDQPRCAVVMRTSVGLVHLLACLLEPFMPSFSLEVFKQLNLPP
ETHISLCDDKGDIDRARRPWEIVPIGHKIGKPEPLFKELKDEEVESLRKKFAGSQADRKE
REEAEAVKVAAQLKKMKVSDNSGKKKQQATKSAAEAEISISRLDIRVGLITKAQKHPDAD
SLYVEEIDVGEGQTRTVVSGLVKYIPIEEMQNRKVCVLCNLKPATMRGIKSQAMVLAAST
SDHATVELVDPPKAAQVGEKVTFPGFVGEPDEVLNPKKKVWETLQVDLHTNTDLVACYRD
IPLTTSAGVCTVSSICGGSIR
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgggagacctcacagttacctccaatgaggaccaaaaggccgccaagctacccatccct
ggcaagcgaaacatcctgatcaccagtgccttgccttacgtcaacaatgtccctcacctt
ggcaatattattggctgcgtgttgagtgctgatgtctttgcccgctactgccgtcttcga
ggctacaatacagtttacatatgtggaactgatgagtacggcacagcgacggagacaaaa
gctatagaagagcagtgtagcccccaagagatatgtgacaaatatcatgcaattcatagg
gaggtttatcagtggtttaacataagctttgagaaatttgggcgcacatcgacaccccaa
caaacagaagtgtgccaagcgattttcaataagctattggagaatgattggctttcagag
aacacaatgcagcagccttactgtgacacatgcaaacggttcttagccgataggcttgtg
gaggggacatgcccaactcaaggctgtgactatgcatctgcacgaggagatcaatgtgag
aactgcggaaagcttttgaatccgacggaactaaaagatcctaaatgcaaggtctgtaag
acaactccacggattcgtgatacaaaccacatgtttttggaacttcctttgctcagggat
aaattggaagagtacatcaataaaacatcagtggctgggtcttggagccaaaatgccatt
caagcgacaaatgcatggctcaaagaggggcttaaacaacgatgtattaccagggatcta
aagtggggtgttccagttccacatgataacttcaaggacaaggttttctatgtgtggttt
gatgctcctattggctatgtctccattactaaatgctacactgatgattgggagaaatgg
tggaagaatcctgagaatgtggagttgtatcagtttatgggcaaagataatgtgccattc
catacagttatgtttccgtcaacacttcttggaactggtgaaaattggactttgatgaag
actatcagtgttactgagtacttaaactacgaagcaggaaagttttctaagagtaaaggc
ataggggttttcggaaatgatgcaaaagatacgaacattcctgttgaagtatggagatat
tacttgctaactaataggcctgaggtatcagacacattatttacgtgggccgacttgcaa
gcaaaactgaacagcgaattactgaataatttgggcaactttataaatcgcgttttgagt
tttgttgccaaaccttcaggtcaaggatatggctccattattccggatgctccaagtgca
gactcagatcttttgacagagaaactggctgaaaaagttggtaaatgtgtggagcaatat
atagaagcaatggagaaggttaaactaaagcaaggactgaaaacagcaatgagcatttct
agtgaagggaatgcatatctgcaagaaagccagttctggaagctttataaggaggaccaa
cctcgttgcgctgttgttatgagaacttcagtcggactagtgcatcttcttgcttgtttg
ttggaaccttttatgccatcattttctctcgaagtatttaagcagcttaatttacctcct
gagacgcacatatcactttgtgatgataaaggagatattgatagggcaagacggccttgg
gagattgtacctattggtcacaagattgggaaaccagagccattgttcaaggaattgaaa
gatgaagaagtggaatccttaaggaagaagtttgctggaagtcaagcggacaggaaggag
agggaagaagctgaagcagtgaaggtggctgcacaactcaagaaaatgaaagtttcagac
aacagtggcaagaaaaagcaacaggccacaaaatcagcagctgaagcagagatttccatt
tctagacttgatattcgtgttggcctcattacgaaagctcagaagcaccctgatgctgat
tcgctttacgtagaagagattgatgttggtgaaggacagactagaacagttgtgagtgga
cttgtcaagtatatacccattgaagaaatgcagaaccggaaggtctgtgttctttgtaat
ctgaagccagcaaccatgcggggtattaaatcacaagcaatggttcttgctgcttcgacc
agtgaccatgccacggttgaattggttgatccaccaaaagctgctcaagttggcgagaaa
gttacatttccagggttcgtcggtgaacctgatgaggtgttgaaccccaagaagaaagtg
tgggagaccttgcaagtggatctgcacactaacactgacctggtggcctgctacagagat
attcccctcacaacatcagctggtgtttgcactgtatcctcaatttgtggcgggtcaatt
agatag

DBGET integrated database retrieval system