KEGG   Prunus persica (peach): 18792827Help
Entry
18792827          CDS       T03092                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pper  Prunus persica (peach)
Pathway
pper03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pper00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    18792827
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pper03041]
    18792827
Enzymes [BR:pper01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     18792827
Spliceosome [BR:pper03041]
 Complex C
  Other components
   Step II factors
    18792827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 T2SSE AAA_19 DUF2075 FtsK_SpoIIIE ATPase DUF2532
Motif
Other DBs
NCBI-GeneID: 18792827
NCBI-ProteinID: XP_007226988
UniProt: M5XQ18
Position
G1
AA seq 714 aa AA seqDB search
MAQGQGRLNSSTKSPKGNLSDGNRKLDAFSKRQTLAQHRKSLPIASVDKRLVEEVQKHDT
LIIVGETGSGKTTQLPQFLYNAGFCGDGKLIGITQPRRVAAVTVAKRVAEECGVNLGEKV
GYSIRFEDMTSSSTRIKYMTDGLLLREALLDPHLSRYSVIIVDEAHERTVHTDVLLGLLK
SVQDARSKSLNNLQNTKNKKTNNDIQLKENGAQGLNFLKQYQGRTPLKLIIMSASLDARI
FSEYFSGARAVHIQGRQFPVDIFYTLHVENDYLDASLATIFQIHLEEGPGDILVFLTGQE
EIESVERLVKERLKQLPENSKKLVAVSIFSSLPSEQQMRVFAPAPPGFRKVILATNIAET
SVTISGIKYVIDPGLVKARYYDPNKGLESLVVVPISKAQALQRSGRAGREGPGKCFRLYQ
EDQFGKFEDSTKPEIKRCNLSNIILQLKALGVDDISGFDFIEKPTRSAIVKSLEQLFLLG
ALTDDCKLSNPVGRQMACLPLDPIYSKALILASEFNCLEEMLITVAMLSVESIFYSPRDK
KEESRTTKKSFASPEGDHLTLVNVYRASNEFLEKRSGLSKEKREKAFRKWCKENFIDSRS
LRHARDIHSQIRRNVEQMGLRVASCGDDVLQFCRCLAASFFLNAALKQPEGSYRALANGE
IVSIHPSSVFFKNKPECLIFNELVETNRKYIRNTTKIDYLWLTELAPQFYAVQN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggtcaaggacggctgaacagctctaccaaaagcccgaaaggaaacttgtcc
gatggtaatcgcaagcttgatgccttttccaagaggcaaacgcttgcgcagcacaggaag
tctcttccaatcgcttctgtggataaacgactggttgaggaggttcagaagcacgatact
ttgattattgttggtgaaactggaagcggaaaaacaacacaattacctcagtttttgtac
aatgctgggttttgcggggatgggaaactcattgggataactcaacccaggcgtgtggct
gccgtgactgtggcaaaacgggttgctgaggaatgtggcgtaaatttgggtgaaaaggtt
ggttactccatcagatttgaggacatgacctctagttcgacaaggatcaagtacatgaca
gatggattgctactgagggaagcactgttggatccacatctctctaggtattcagtcata
attgttgatgaagctcatgagagaactgtccacactgatgtgttgctaggattgctaaaa
agcgtacaagatgcaaggtcaaaatccctcaataacctccaaaatactaaaaacaagaaa
acaaataatgacatacaattgaaagaaaacggtgctcagggcctcaattttctcaagcaa
taccaaggaaggaccccgttgaagttaattatcatgtctgctagcttggatgcacgaatt
ttctccgagtacttcagtggtgccagagctgttcacatccaagggcgacagtttcctgtg
gatatattttatactcttcatgttgaaaatgattatctagatgcttcgttagccaccata
tttcagattcatctggaggagggccctggtgatatacttgtattcttgacgggtcaagaa
gaaatcgaatctgtagaaagacttgtcaaagaaagacttaaacagttaccagaaaacagt
aaaaaactagtggctgtttctatattctcatctcttccttcagaacagcaaatgcgagtt
tttgcaccagcccctcctggatttcgtaaggtaatattggcaacgaatattgctgagaca
tcagtgacaatatctggaataaagtacgttatagatcctgggttagtaaaagcacgttac
tatgacccaaacaaagggttggaatctttggttgttgttccaatttcaaaagcacaagct
cttcaaaggagtgggcgtgcagggcgagaaggaccagggaagtgcttccgcctctaccaa
gaggatcaatttgggaaatttgaggattcaacaaagccagagatcaagcggtgcaacctc
tctaatatcattttgcaacttaaggccctgggtgttgatgatatcagtggatttgacttc
atagaaaagcctacaaggtcggctattgtcaaatcactagagcaattgttcctgctgggt
gctttaacagatgactgtaaattatcaaatccagttggacgccaaatggcttgccttccc
ttagacccaatttattcaaaagctctaatcctagcgagtgaattcaattgcctggaagag
atgctgataactgttgcaatgctctcagtagaatctatattttatagtccccgtgacaaa
aaagaagagtcgagaactacaaagaaatcctttgcaagtccagagggagaccatctcact
ttggttaatgtatatagagcgtccaatgagttcttggaaaagagatcaggtcttagtaaa
gagaagcgtgaaaaagctttccgaaaatggtgcaaggaaaatttcattgatagtcgctcc
ctgaggcatgctcgtgacattcacagccaaattcgacgaaatgttgaacaaatgggtctt
cgtgttgcctcttgtggtgacgacgtgcttcagttttgcagatgccttgcagcttctttc
ttcctcaatgcagctttaaagcagcctgagggatcatacagggctttagcaaacggtgag
atagtgtcgatccacccatcttcagtgtttttcaagaacaaaccagagtgcctaattttc
aatgaactagtcgaaactaatcgtaaatacatccgcaacacaactaagatcgattatttg
tggttaactgagcttgctcctcaattctatgccgtgcagaattaa

DBGET integrated database retrieval system