KEGG   Prunus persica (peach): 18793848Help
Entry
18793848          CDS       T03092                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pper  Prunus persica (peach)
Pathway
pper00630  Glyoxylate and dicarboxylate metabolism
pper00710  Carbon fixation in photosynthetic organisms
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
pper01200  Carbon metabolism
Module
pper_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pper_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pper_M00532  Photorespiration
pper_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    18793848
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18793848
Enzymes [BR:pper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     18793848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 18793848
NCBI-ProteinID: XP_007223576
UniProt: M5XZN2
Position
G1
AA seq 175 aa AA seqDB search
MSSAIFNAPVAASGYVGLSTNPPKIFPVKDSIGWTKKTVSNGSRTHCMKVWNPINNKKFE
TLSYLPPLSDDSIAKEIDYMLKKGWIPCLEFDEIGHIYRENSTMPGYYDGRYWTLWKLPM
FGCTDPSLVLNEIYQCKTAYPNAYIRCMAFDNINQGQCMAFIIQKPAAATITTNA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgcaatcttcaatgctccggttgctgcatccggctacgttggcctgtcaacc
aaccctccgaaaattttcccggttaaagattcgattggatggaccaagaaaactgtctcc
aatggttcaagaactcactgcatgaaggtatggaacccaatcaacaacaagaagtttgag
acactgtcctaccttccaccactctctgatgattcaattgcaaaggagattgactacatg
ctcaagaaaggatggatcccttgcctcgaattcgatgagatcgggcatatttacagggag
aatagcacgatgccaggctactacgatgggagatactggacattgtggaagctgcccatg
tttggttgcactgacccgtctctggtgctcaatgaaatctaccagtgcaaaacagcttac
ccaaatgcttatatacgctgtatggcatttgacaacatcaaccagggccagtgtatggcc
tttatcattcagaagccagccgccgccaccatcaccaccaacgcttaa

DBGET integrated database retrieval system