KEGG   Pseudomonas putida F1: Pput_0025
Entry
Pput_0025         CDS       T00537                                 

Definition
(GenBank) Putative protein-S-isoprenylcysteine methyltransferase-like protein
Organism
ppf  Pseudomonas putida F1
SSDB
Motif
Pfam: PEMT ICMT NnrU DUF1295
Other DBs
NCBI-ProteinID: ABQ76201
UniProt: A5VWE1
Position
complement(28545..29204)
AA seq 219 aa
MNHGESAYGLWSLVFINSAIFIMFAFSFFKPATARDWRSFGAFSAFIVALFVEMYGFPLT
IYLLSGWLQARFPNLDLLSHESGHLWSTLLGDQGNPHFSVLHIASYLFLGFGFYLLSAAW
NVLYHAQRRRSLATVGPYGWIRHPQYVAFVLILLGFLLQWPTLLTLAMFPVLLVMYGRLA
VSEEREMHKQFGAAYEAYTRVTPRFVPHLRERLGGGHRG
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaatcatggtgaaagcgcgtatggcctctggtcgctggttttcatcaactccgcgatc
ttcatcatgtttgccttcagtttcttcaagccggcaacggcgagagactggaggagcttc
ggtgcattctcggccttcatcgttgccctgtttgtggaaatgtatggcttccccctgacg
atctatctgttgtcaggctggttgcaggccaggttccccaacctcgatctgctttcccac
gaatccggccatctgtggtcgacgttgctcggtgaccagggcaacccacacttcagtgtt
ttgcacattgccagttacctattcctgggtttcggcttctatttgctttctgccgcctgg
aacgtgctatatcacgcgcaacgccgccgttcacttgcaacggtcgggccctatggctgg
atcagacatccgcagtacgtggcatttgtgctgattcttctgggctttctccttcagtgg
ccgacgctgctgacgctggcaatgttcccggtgttgctggtgatgtacgggcgtttggcg
gtttccgaagagcgggaaatgcacaagcagtttggcgctgcctacgaagcttatacccgc
gttacgcctaggttcgttccgcacctgcgcgaaaggttgggtgggggtcatagaggctga

DBGET integrated database retrieval system