KEGG   Pseudomonas putida F1: Pput_0764Help
Entry
Pput_0764         CDS       T00537                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00471  D-Glutamine and D-glutamate metabolism
ppf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Pput_0764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppf01011]
    Pput_0764
Enzymes [BR:ppf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Pput_0764
Peptidoglycan biosynthesis and degradation proteins [BR:ppf01011]
 Precursor biosynthesis
  Racemase
   Pput_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ABQ76928
UniProt: A5VYG8
Position
857634..858431
Genome map
AA seq 265 aa AA seqDB search
MAERSAPVGVMDSGVGGLSVLAEIQRLLPNETLLYVADCGHIPYGEKSPDYIRERCRHIA
EFFHEQGAKAMVLACNTATVAAVADLRELYPTWPLVGMEPAVKPAAAATRSGVVGVLATT
GTLQSAKFAALLDRFANDVQVITQPCPGLVELIETGDLASPALRQMLQGYVQPLLAAGCD
TLILGCTHYPFLRPLLAGMVPNDVAIIDTGAAVARQLRRLLGANDLLAKGPAGAARFWTS
ADPEALRKILPVLWHKSDDVQSFAL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgctctgcgccggtcggcgtcatggactcgggggttggcggtttgtcggtg
ctggccgagatccagcgcctgctgcccaacgagacgttgctgtatgtggccgactgcggg
catataccctacggtgagaagtcgccggactatatccgcgagcgctgccggcacattgcc
gaattcttccatgagcaaggcgcaaaggccatggtgttggcctgcaacaccgccacggtg
gctgcagtggccgacctgcgcgagttgtatccgacctggccgttggtgggcatggaaccg
gccgtcaagcctgcagcggcagccacccgctcgggcgtggtcggtgtgctggccaccacc
ggtaccctgcagagtgccaagttcgcagccttgctcgaccgcttcgccaacgacgtacag
gttattacccagccttgcccggggctggtcgaactgatcgaaaccggtgaccttgcaagt
ccggcgttgcgccagatgctgcaaggttacgtgcagccgctgctggcagcaggttgcgat
acgctgatcctcggctgcacccattaccctttccttcgcccattgctggccggcatggtg
ccgaatgacgtggccatcatcgacaccggcgcggccgtggcgcgtcagttgcgacggctg
ctgggtgccaatgatctcttggccaaaggcccggccggcgctgcacgcttctggaccagc
gctgacccagaagccttaagaaaaatcctacctgtgctgtggcataagtctgacgatgtg
caaagctttgcgttgtga

DBGET integrated database retrieval system