KEGG   Pseudomonas putida F1: Pput_1037Help
Entry
Pput_1037         CDS       T00537                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00220  Arginine biosynthesis
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01130  Biosynthesis of antibiotics
ppf01230  Biosynthesis of amino acids
Module
ppf_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Pput_1037
Enzymes [BR:ppf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Pput_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ABQ77198
UniProt: A5VZ88
Position
complement(1163728..1164738)
Genome map
AA seq 336 aa AA seqDB search
MAFNIHNRNLLSLEHHTTRELRYLLDLSRDLKRAKYTGTEQQHLKGNNIALIFEKTSTRT
RCAFEVAAYDQGANVTYIDPNSSQIGHKESMKDTARVLGRMYDAIEYRGFKQEIVEELAK
FAGVPVFNGLTDEYHPTQMIADVLTMREHSDKPLHDISYAYLGDARNNMGNSLLLIGAKL
GMDVRIAAPKALWPHDDLVERCKQYAEESGARITLTEDPKAAVKGVDFVHTDVWVSMGEP
IEAWGERIKQLKPYQVNAELMKSTGNPRTKFMHCLPAFHNSDTKVGKQIAEQYPDLANGI
EVTDDVFESPACIAFEQAENRMHTIKAILVSTLADL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaacattcacaaccgcaacttgctcagcctggaacaccacaccacccgtgag
ttgcgctatctgctggacctgtcccgcgacctcaagcgcgccaagtacaccggcaccgag
cagcagcacctgaagggcaacaacatcgccctgatcttcgaaaaaacctccacccgtacc
cgttgtgccttcgaagtcgcagcctatgaccaaggcgccaacgtcacctacatcgacccc
aactcctcgcagatcggccacaaggaaagcatgaaggacaccgcccgtgtgctcgggcgc
atgtatgacgccatcgagtaccgtggcttcaagcaggaaatcgtcgaagagctggccaag
ttcgccggcgtaccggtgttcaacggcctgaccgacgaatatcaccccacccagatgatc
gccgacgtgctgaccatgcgtgagcacagcgacaagccgctgcacgacatcagctacgcc
tacctgggcgatgcccgcaacaacatgggcaactcgctgctgctgatcggcgccaagctg
ggcatggatgtgcgcatcgccgcgcccaaggcactgtggccacatgacgatctggtcgag
cgctgcaagcagtatgctgaagaaagcggcgcacgcattaccctcaccgaagacccgaaa
gccgcggtcaagggtgtcgactttgtgcataccgacgtgtgggtatcgatgggcgagccg
atcgaagcctggggtgagcgcatcaagcagctcaagccttatcaggtgaatgccgaactg
atgaagtccaccggcaacccgcggaccaagttcatgcactgcctgccggcattccacaac
tccgacaccaaggtaggcaagcagatcgccgaacaatacccggacctggccaacggcatc
gaagtgaccgatgacgtgttcgaatcgccagcgtgcatcgccttcgagcaggcggaaaac
cgcatgcacacgatcaaggcgatcctggtatcgaccctggctgatctgtaa

DBGET integrated database retrieval system