KEGG   Pseudomonas putida F1: Pput_1205Help
Entry
Pput_1205         CDS       T00537                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00053  Ascorbate and aldarate metabolism
ppf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Pput_1205
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Pput_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short NmrA
Motif
Other DBs
NCBI-ProteinID: ABQ77366
UniProt: A5VZQ6
Position
complement(1364003..1364809)
Genome map
AA seq 268 aa AA seqDB search
MTTTPFNRLLLTGAAGGLGKVLRERLKGYAEVLRLSDISPMAPAAGPHEEVITCDLADKA
AVHALVEGVDAIIHFGGVSTEHAFEEILGPNICGVFHVYEAARKHGVKRIIFASSNHTIG
FYRQDERIDAHAPRRPDSYYGLSKCYGEDVASFYFDRYGIETVSIRIGSSFPQPQNPRML
CTWLSYDDLVQLIERGLSTPDVGHTIVYGASDNRTVWWDNRHAAHLGYVPKDSSEAFRAA
VEAQPAPPADDPSMVYQGGAFAVTGPFN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaccactacccccttcaatcgcctgctgctcaccggagccgcaggcggcctgggcaag
gtccttcgcgaacgcctgaaaggctacgccgaggtcctgcgcctttccgacatcagcccc
atggcgcctgctgctggcccgcatgaggaagtcatcacctgcgacctggccgacaaggct
gcggtgcatgcactggtcgaaggcgtggacgccatcatccacttcggcggggtttctacc
gagcacgccttcgaagagattctcggccccaatatctgtggcgtgttccacgtgtacgag
gcggcgcgcaagcatggggtcaagcgcatcatcttcgccagctccaaccacaccatcggt
ttctaccgccaggatgagcgcatcgacgctcacgcgccgcgccgccccgacagctattac
gggctgtccaagtgctacggcgaagatgtggccagcttctactttgaccgctacggcatc
gagaccgtcagcattcgcatcggctcgtcgttcccgcagccacagaacccgcgcatgctc
tgcacctggctgagctatgacgacttggtgcaactgatcgaacgtgggctatcgacgccc
gacgttggccataccatcgtctacggcgcctccgacaatcgcaccgtgtggtgggacaac
cgccatgccgcgcacctgggctatgtgcccaaggacagctcggaagccttccgcgcagcc
gtggaggcacaaccggccccccccgccgatgacccgagcatggtctaccagggcggcgct
ttcgccgtgaccggcccgttcaactga

DBGET integrated database retrieval system