KEGG   Pseudomonas putida F1: Pput_1748Help
Entry
Pput_1748         CDS       T00537                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00630  Glyoxylate and dicarboxylate metabolism
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01200  Carbon metabolism
Module
ppf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pput_1748
Enzymes [BR:ppf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pput_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABQ77904
UniProt: A5W194
Position
complement(1999917..2001242)
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSVQPEHTFARQGAEKLWKLVT
EGAHPSFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNAFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVVGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgaaaacccg
cgctggaaaggcgtgacccgtacctacaccgccgctgatgtcgttcgcctgcgtggctcc
gtgcaacctgagcacacctttgcgcgtcagggcgcagaaaaactgtggaagctggtcacc
gaaggtgcccacccgtccttccgccccgaaaaagatttcgtcaactgcatgggcgccctg
acgggcggccaggctgtacagcaggtcaaggccggcatccaggccatctacctgtccggc
tggcaggttgccgccgacaacaactcggccgagtcgatgtaccctgaccagtcgctgtac
ccggtcgactcggtaccgaccgtggtcaaacgcatcaacaacgcgttccgccgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgaagggtacatcgactacttcgcg
cccatcgtggccgacgccgaagccggtttcggtggcgtactgaacgcctacgagctgatg
aagaacatgatcgaagcaggcgccgccggcgtgcacttcgaagaccagctggcctcggtt
aaaaaatgcggccacatgggcggcaaggtgctggtgccgactcaggaagccgtacagaag
ctggtggccgctcgcctggccgctgacgtgtcgggtgtaccgaccatcattctggcccgc
accgacgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtggttggcgagcgcacccgcgaaggcttctacaaggtccgtgccggcctcgatcaggcc
attgcccgcggcctggcctatgccccgtacgccgacctgatctggtgtgaaaccgccaag
ccggacctggacgaagcccgtcgcttcgccgaggcgatcaagaaggagtacccggaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgccacc
atcgccaagttccagcgcgaactgtcggccatgggttacaagcatcagttcatcaccctg
gccggcatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgctgacgccagcaagggctac
accttcgtggcgcaccagcaggaagtgggcactggctacttcgacgacatgaccaccgtg
atccagggtggcgcttcgtcggtgactgcactgaccggctcgaccgaggaagagcagttc
cactga

DBGET integrated database retrieval system