KEGG   Pseudomonas putida F1: Pput_1796Help
Entry
Pput_1796         CDS       T00537                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00030  Pentose phosphate pathway
ppf00480  Glutathione metabolism
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01130  Biosynthesis of antibiotics
ppf01200  Carbon metabolism
Module
ppf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppf_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ppf_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pput_1796
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pput_1796
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppf04147]
    Pput_1796
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Pput_1796
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Pput_1796
Exosome [BR:ppf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Pput_1796
  Exosomal proteins of colorectal cancer cells
   Pput_1796
  Exosomal proteins of bladder cancer cells
   Pput_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABQ77949
UniProt: A5W1D9
Position
2060952..2062457
Genome map
AA seq 501 aa AA seqDB search
MTKQTLAAAPPCTLFLFGANGDLVKRLLMPALYNLSRDGLLDRNLRIVGVDHNPASAEDF
AARLHAFMVERDKGSEGSAKCLDEKLWARLAKRLDYQTGDFLDPATYQALARRIDKTRHG
NAIFYLATSPRFFPEVAQRLGQAGLLDESAGGFRRVVVEKPFGTDLASAEALNACLLKVM
GERQIYRIDHYLGKETVQNILVSRFSNGLFESFWNNHYIDHVQITAAETVGVETRGAFYD
STGALRDMVPNHLFQLLAMVAMEPPAAFGADAVRGEKAKVVGAIRPWSAKMALKNSVRGQ
YSAGKQGRKPLPGYRQEANVAPDSQTETYVALKVMIDNWRWAGVPFYLRTGKRMSVRDTE
IAICFKPAPYAQFRESELERPKPNYLKIQIQPNEGMWFDLQAKRPGPELVMENVELGFAY
KDFFKMTPATGYETLIYDCLTGDQTLFQRADNIENGWRAVQPFLDAWAQGGEVHEYSAGE
DGPEAGNELLTRDKREWHRLG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacagacccttgcggccgcccccccttgtaccctgttcctgttcggcgccaat
ggcgacctggtcaagcgcctgctgatgcccgcgctgtacaacctcagccgcgacggtttg
ctggaccgtaacctgcgcatcgtcggcgtcgaccataacccggccagcgccgaggatttc
gccgcgcgcctgcacgcgttcatggtcgagcgtgacaaaggaagcgagggcagcgccaag
tgcctggacgagaaactatgggcccgcctggccaagcgcctggattatcagacgggcgac
tttctcgatccggccacctaccaggccctggccaggcgcatcgacaagacccgccacggc
aatgccattttctatctggccacgtcgccgcgcttcttccccgaggtggcgcagcgcctg
gggcaggccggcctgctggacgagtctgccggcggctttcgccgggtggtggttgaaaaa
ccgttcggcaccgacctggccagcgccgaggcgctcaacgcctgcctgctgaaggtgatg
ggcgagcggcagatctaccgcatcgaccattacctgggcaaagagacggtgcagaatatt
ctggtcagccgcttttccaacggcctgttcgaatcgttctggaacaaccactacatcgac
cacgtgcagatcaccgcagcggaaaccgtcggtgtcgagacccgtggtgcgttctatgac
agcaccggcgccctgcgcgacatggtgcccaaccacctgttccagttgctggcgatggtg
gccatggagccgccggccgcgttcggtgccgatgcggtgcgcggtgaaaaagccaaggtg
gtcggcgctattcgcccatggtcggcaaaaatggccctgaagaactccgtgcgaggccag
tacagcgctggcaagcaggggcgcaagccgttgccaggctaccgtcaggaggccaacgtc
gcgccggatagccagaccgagacctacgtggcgctgaaggtgatgatcgacaactggcgc
tgggccggcgtgccattttacctgcgcaccggcaagcgcatgagcgtgcgtgacaccgag
attgccatctgcttcaagcccgcaccgtatgcgcagtttcgcgagtcggagctggaacgg
cccaaacccaactacctgaaaatccagatccagcccaatgaaggcatgtggttcgatctg
caagccaaacggcccgggccagagctggtgatggagaatgtcgagttgggttttgcctac
aaggacttcttcaagatgaccccggccactggctacgagacgctgatctatgactgcctg
accggtgaccagaccctgttccagcgggctgacaacatcgaaaacggctggcgagcggtg
cagccgtttctcgatgcctgggcccagggcggcgaagtgcatgagtactcggctggcgaa
gatgggcctgaggccggcaatgaattgctgacccgcgacaagcgggagtggcaccggttg
gggtga

DBGET integrated database retrieval system