KEGG   Pseudomonas putida F1: Pput_2118Help
Entry
Pput_2118         CDS       T00537                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ppf  Pseudomonas putida F1
Pathway
ppf02025  Biofilm formation - Pseudomonas aeruginosa
ppf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pput_2118
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Pput_2118
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppf02044]
    Pput_2118
Secretion system [BR:ppf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pput_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ABQ78257
UniProt: A5W297
Position
complement(2398843..2399358)
Genome map
AA seq 171 aa AA seqDB search
MPTPAYIKIVGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPS
GQRVHKPFIFTSSLNKATPLMYQALATGEMLPTVEVSWYRTSEEGKQEHFFTTTLEDATI
VSINTVLPHALDKDNENYTQLIEVSLAYRKITWAHDVANTEGSDDWRNPIA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgccaacacccgcttacatcaagatcgtaggccagacccaaggcaacatcaccgctggc
gccttcaccgctgactccgtcggcaacgtgttccaacaaggccatgaagatcaaattctg
gttcaggaaatcaagcatgaggtgactacgcccactgacccccagagcggtcaaccgagt
ggccagcgcgtgcataagcctttcatattcaccagttcactgaacaaagctacccccctg
atgtatcaggcacttgccaccggcgaaatgctgccaacggtcgaagtcagctggtatcgc
acctcggaggaaggcaagcaagagcactttttcacgaccacgctagaagacgccaccatc
gtcagcatcaataccgtgcttccccatgcactcgacaaagacaatgaaaactacacacaa
ctgattgaagtatccctggcgtatcgaaagatcacgtgggctcacgatgtagccaatacc
gaaggttctgacgactggcgcaatccgatcgcctga

DBGET integrated database retrieval system