KEGG   Pseudomonas putida F1: Pput_2122
Entry
Pput_2122         CDS       T00537                                 

Definition
(GenBank) FHA domain protein
  KO
K11894  type VI secretion system protein ImpI
Organism
ppf  Pseudomonas putida F1
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppf02044]
    Pput_2122
Secretion system [BR:ppf02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Pput_2122
SSDB
Motif
Pfam: FHA Zot
Other DBs
NCBI-ProteinID: ABQ78261
UniProt: A5W2A1
Position
complement(2402549..2403118)
AA seq 189 aa
MNTVTLSITNLDQLQHGVTARHLFDCKGGTIGSGRANWQINDRDQTVAPIHCEIRWIEGS
FCVIDHCHRTYLNGSANSLGPLPPRRLVEGDQLLIGTYRLQVQYTQDQACTRSLEDLFNP
DPRVLDRLIAEAPAPAWPAQPSAPQPAVEICSVFKAAMGNDPLAALDAADGEGALRESPL
QRLIAGAYP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaacacagtcaccttgagcatcaccaacctcgaccaactgcagcacggcgttactgct
cggcacctgttcgattgcaagggcggcaccatcggcagcgggcgagcaaactggcagatc
aatgaccgcgatcagaccgttgcgcccatccactgcgaaatccgctggatcgaaggcagc
ttctgtgtgatcgaccactgccaccgtacctacctcaatggcagtgccaacagcctgggg
ccgcttccacccagacgcctggttgagggtgaccagcttctcattggtacctatcggcta
caggttcagtacacccaggatcaggcctgcacgcgctcgctggaggacctgttcaacccg
gacccgagggtgctcgaccgcctgatagcggaagcgcctgcacccgcttggccggcacag
ccttctgccccccaaccagccgtcgagatctgctcggtcttcaaagcagccatggggaat
gaccctctggcagcgctggacgcagcagacggtgaaggggcgctccgagaaagcccgctg
cagcgcctgattgccggagcatacccatga

DBGET integrated database retrieval system