KEGG   Pseudomonas putida F1: Pput_2123Help
Entry
Pput_2123         CDS       T00537                                 

Definition
(GenBank) protein of unknown function DUF1305
  KO
K11895  type VI secretion system protein ImpH
Organism
ppf  Pseudomonas putida F1
Pathway
ppf02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Pput_2123
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppf02044]
    Pput_2123
Secretion system [BR:ppf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pput_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG FAD-oxidase_C
Motif
Other DBs
NCBI-ProteinID: ABQ78262
UniProt: A5W2A2
Position
complement(2403115..2404131)
Genome map
AA seq 338 aa AA seqDB search
MANTDRQATADLADKLLCEAHQYNFFQLLERLHGLHGDDLEPRWPDKATRRRVRLACDPR
LTFPVSDVYKAQRMPAEEARYRIVATFLGLHGTDSPLPTYYLEQVAYEHAHGIGVRPAFF
DFFNHYLLSLLHRIWRKYRYYIRFQPGASDGFSQYVFALLGLNDKQLRGDTALPWSRLLS
FAGVIASRSRAPGTVAGIIAHCFDLNQVHIREFETRSVVTPSRQLARLGRTNGQLGSTFM
IGSRTRTRSSKFTIVISELDQTQLRDLLPSGINFGRLRALIDFLLRDGLAYDLELRLKPS
ALSPFCLHRSQGAYLGWTSFVDDRHGQISPVVRIRGRS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggccaatacagaccggcaagcaaccgctgatctagccgacaagctgctttgcgaagcg
caccagtacaacttcttccagttgctggagcggttgcacgggctgcatggcgatgacctg
gaaccccgttggccggacaaggccacccggcggcgcgtgcgcctggcctgcgacccacgg
ctgaccttccctgtatcggacgtgtacaaagcccagcgaatgcccgctgaggaagcgcgc
taccgtatcgttgccacgttcctggggttgcacggcaccgattcgccattgcccacctat
tacctggaacaggtggcgtatgaacatgcgcatggcatcggtgtacgcccggccttcttc
gacttcttcaaccactacctgctcagcctgttgcaccgtatctggcgcaagtaccgctat
tacatccgcttccagccaggtgccagtgacgggttctcgcagtacgtgtttgccctgctt
gggcttaacgacaagcagttacgaggggacacggcgctgccctggagccgcctgctcagt
tttgccggcgtgatcgccagccgcagccgtgcgccgggcactgtggccggcatcattgcg
cactgcttcgacctcaatcaggtgcacatccgcgagttcgagacgcgatcagtcgtcacg
ccgtccaggcagcttgcaaggctggggcggaccaatggccagctgggcagcacgttcatg
attggcagccgcacgcgcactcgcagcagcaagttcaccatcgtgatcagcgaactcgac
cagacacagctgcgggacttgctgcccagcggcatcaacttcggccgtttgcgtgcactg
atcgactttctgctgcgtgacgggctggcctacgacctggaactgcgccttaagccgagc
gcgttgtcccccttctgcttgcaccgcagccagggcgcatacctgggctggaccagcttc
gtcgatgaccggcatggccagatcagcccggttgtacgcatccgggggcgctcatga

DBGET integrated database retrieval system