KEGG   Pseudomonas putida F1: Pput_2622
Entry
Pput_2622         CDS       T00537                                 

Definition
(GenBank) uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
ppf  Pseudomonas putida F1
Pathway
ppf02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Pput_2622
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppf02044]
    Pput_2622
Secretion system [BR:ppf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pput_2622
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABQ78756
UniProt: A5W3P6
Position
2991568..2992107
AA seq 179 aa
MAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLKDR
KFVYIDRDNFNGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPL
RKLLEVRNKLADLRNKMGGNDKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSDDRA
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcgaagaaggaaagcactcagcacaaactcgaccgcgttcgcgcgcctcgggtccat
atcacctacgacgtggacatcggcgatgccatcgagaaaaaggagctgcccttcgtcgtc
ggcgtactgggtgacttctccggcaacccgctggagccgctgcccaagctcaaggaccgc
aagttcgtgtacatcgaccgcgacaacttcaacggtgtgctcaagggcatcaagccacgc
ctgacctaccgcgtcgacaacaccctggccaagaacggtacccagttgggcgtggagctg
aacttcaacagcctcgaagatttcgagccacagaacgtggtcaagcaggtcgagccgctg
cgcaagctgctggaagtgcgcaacaagctggccgacctgcgcaacaagatgggcggcaac
gacaagctcgaagagctgctgatggacgtgctgcagaacaccgaaaagctcaagaccttg
ggcaaggaattcggccgtgaagccgaagtgaaagacccgtccagcgacgatcgcgcctga

DBGET integrated database retrieval system