KEGG   Pseudomonas putida F1: Pput_2882
Entry
Pput_2882         CDS       T00537                                 

Definition
(GenBank) 2-hydroxymuconate semialdehyde hydrolase
  KO
K10702  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [EC:3.7.1.25]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00622  Xylene degradation
ppf01100  Metabolic pathways
ppf01120  Microbial metabolism in diverse environments
ppf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    Pput_2882
Enzymes [BR:ppf01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.25  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase
     Pput_2882
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 BAAT_C Ndr Abhydrolase_3 Abhydrolase_4 Palm_thioest
Other DBs
NCBI-ProteinID: ABQ79013
UniProt: P23133
Position
complement(3273186..3274016)
AA seq 276 aa
MTNVNAEIGRMVLAGGIETNLHDVGAGNPVVLVHGSGPGVTAWANWRTVMPELSRHRRVI
APDMVGFGFTQRPHGIHYGVESWVAHLAGILDALELDRVDLVGNSFGGALSLAFAIRFPH
RVRRLVLMGAVGVSFELTDGLDAVWGYEPSVPNMRKVMDYFAYDRSLVSDELAELRYKAS
TRPGFQEAFASMFPAPRQRWVDALASSDQDIRDIRHETLILHGRDDRVIPLETSLRLNQL
IEPSQLHVFGRCGHWVQIEQNRGFIRLVNDFLAAED
NT seq 831 nt   +upstreamnt  +downstreamnt
atgacgaatgtaaacgcagagatcggccgcatggtgctggctggtggaatcgagaccaat
ctccatgatgttggcgccggcaaccctgtggtactcgttcatggttcaggcccaggtgtg
accgcctgggcgaactggaggacggtcatgcctgagttatccaggcatcgccgcgtcatt
gcgccggacatggtgggcttcggtttcacacagcggccgcacgggattcactacggcgtc
gagtcctgggttgcacatctggctgggatccttgatgccctggaactcgaccgtgtcgat
ctcgtggggaattcgttcggcggtgccttgtctctggcctttgctatccgatttccgcat
cgggttcgccgcctggtgctgatgggtgccgttggcgtgagcttcgagctcacggatgga
ctggatgcagtttggggttatgagccgtccgtgccgaacatgcgcaaggtcatggactac
ttcgcctacgaccgaagtctcgtttccgacgaactggcggaactgcgctacaaggcgagc
acccggcccggttttcaggaggccttcgcttccatgttccctgctccgcggcagcgctgg
gtagatgcgctggccagttccgatcaggacatccgggacatccggcatgaaacgctgatc
ctgcatggccgcgacgatcgcgtgattcccctcgaaacctcgttgcggctgaaccagctg
atcgaaccctcccagttacatgtctttggcaggtgtggccattgggtgcagatcgagcaa
aaccggggctttatccgcttggtcaacgattttcttgccgcggaggactga

DBGET integrated database retrieval system