KEGG   Pseudomonas putida F1: Pput_2929
Entry
Pput_2929         CDS       T00537                                 

Definition
(GenBank) hypothetical protein
Organism
ppf  Pseudomonas putida F1
SSDB
Motif
Pfam: LPAM_1
Other DBs
NCBI-ProteinID: ABQ79057
UniProt: A5W4J7
Position
3314704..3315219
AA seq 171 aa
MHTPTLSTLGLMIALAGCSTPPPAPAPAPAAPPALPAALPKPKAQLPAWVRQDRYTLVTT
RPTLEQRQPLYQLVNVQIAPALHATVGEALRHLLQRSGYALCADSAAVDRLFRRPLPAVQ
HQFGPISLLDALTIIAGPAWRLEIDPVDRTVCYALRVPSPAPPFSTLEIAP
NT seq 516 nt   +upstreamnt  +downstreamnt
atgcacacacccacactctccaccctcggactgatgatcgccctggcgggctgtagcacg
ccgccaccggctccggccccggctcccgcagcgccacccgcgttgccggcggcattgccc
aagccgaaagcccagctgccggcctgggtgcgccaggaccgttacaccctggtcacgacc
cggcccacgctggagcagcgccagccgctgtatcaattggtcaacgtacaaattgcgcca
gccctgcatgccaccgtcggtgaagccctgcgtcacctgctgcaacgctcaggctacgcg
ttgtgtgccgatagcgcagcggtggatcgcttgttccgtcgccctctgcctgcagtacag
caccaattcggccccatctcactgctggacgccctgaccatcatcgccggcccggcttgg
cgactcgagatcgatccagttgatcggaccgtgtgctatgccctgcgcgtgccgtcgcct
gcacctcctttctcgacactggagattgcgccatga

DBGET integrated database retrieval system