KEGG   Pseudomonas putida F1: Pput_2948Help
Entry
Pput_2948         CDS       T00537                                 

Definition
(GenBank) Type IV secretory pathway VirB4 components-like protein
Organism
ppf  Pseudomonas putida F1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraC_F_IV AAA_22 FtsK_SpoIIIE TrwB_AAD_bind DUF87 AAA_10 AAA_29 AIG1 T2SSE
Motif
Other DBs
NCBI-ProteinID: ABQ79076
UniProt: A5W4L6
Position
3328392..3331133
Genome map
AA seq 913 aa AA seqDB search
MADDASRDPSRWKPWRAAQRRRATLADETAQYAHNPSFTDHLPWVEYLEEGQCFLLDDNR
SVGAVFELQPIGTEGREPEWLMAARDALEDALQDSFDELDQAPWVVQFFCQDDSDFAPYL
ERLERYIAPRARGRPFTEAFLASMRRHLEAVGKPGGLFDDHVVSHLPWRGSNRRIRLVVY
RWLGEQADEDGQSPVQLLNRTCDRLVASLQACGVSPRRLTGRDFYAWLLPWFNPAPALTG
ESPAAFYRRVPYPEVDDGEELPLPFDHDFAERLFFQEPRSNSEQGLWYFDQQPHAVMVVD
KLRRPPHIGQLTGETRKGEALNALFDQLPEQSVMSLTLVITPQDVLEEQLNRLARKAIGE
NLASTQTRQDVEEARALIGRQHKLYRGTLALYLRGADEQQLRQRSVQAANVLLGAGLQPV
REGDEVAACNSYLRWLPMVYNPARDTRNWYTRLLFAQHVANLLPLWGRSIGTGNPGITFF
NRGGAPLSFDPLSRFDRSMNGHLLLFGPTGAGKSATLVSILMQVMAVYRPRLFIVEAGNS
FGLQGDYFATLGLTVNKVQLKPGSDVSLAPFAHARRLIEHPDQVASLSTEELDEAAPDSG
EQRDVLGELEITARLMITGGEAKEEARLTRADRSLIRECILDAARHCATTEQQVLTRHVR
DALRKVASDTHLPDKRRERAQEMAESIDLFCQGFEGALFDRAGTPWPESDVTIVDLATYA
REGYEAQMSISYISLMNTVNNIAERDQYLGRPIIMVTDEGHIITKNPLLAPFVVKGTKMW
RKLGAWFWLATQNMADLPDAAQTMLNMIEWWICLNMPPAEIEEIARFKKLTPAQKVLLLS
ASKASGKYTEGVVLSKNLETLFRAVPPSLYLALAMTEPEEKAQRWRLMEEHQQPELEAAL
QVAAEIDRLRGMS
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgacgcgagtcgcgatccgtcccgctggaagccctggcgcgcggcacagcgc
cggcgcgccaccctggccgacgaaaccgcccagtacgcgcacaaccccagcttcaccgac
cacctgccctgggtcgagtatctggaagagggacagtgctttctgcttgatgacaaccgt
tctgtgggtgccgtattcgagctgcaaccgatcggcacggagggtcgcgagcccgaatgg
ttgatggccgcacgcgacgccctggaagatgcgctgcaggacagcttcgacgagctcgat
caggcgccctgggtggtgcagttcttctgccaggacgacagtgattttgccccgtacctt
gaacgcctggagcgctacatcgcgccgcgcgcgcgaggtaggccgttcaccgaggccttc
ctcgcctcgatgcgccgccatcttgaagccgtcggcaaaccgggtgggctgttcgacgac
catgtggtgtctcaccttccgtggcgcggtagcaatcggcgtattcgcctggtggtctac
cgctggctcggggagcaggctgacgaggatgggcagagcccggtccagctgttgaaccgc
acctgcgaccgcttggtggcctcgctgcaggcctgcggggtcagccctcggcggctgacc
gggcgcgacttttacgcctggttgttgccttggttcaacccggcaccagccctcactggc
gaatcccccgccgcgttctatcgacgtgtgccctacccggaagtggatgacggtgaggag
ctgccgctgccgttcgaccacgatttcgccgagcggctgttctttcaggaaccacgctca
aatagcgagcaaggtctgtggtacttcgatcagcaaccgcacgccgtgatggtggtcgac
aagctgcgcaggccgccgcatatcggccagctgaccggtgaaacgcgcaaaggcgaagcg
ttgaacgccttgttcgatcagttgcccgagcagtcggtcatgagcctgaccttggtgatc
acgccccaggatgtgctcgaggagcagctcaatcgcctggcgcgcaaagccatcggcgag
aacctcgcctcgacccagacccgccaggacgtggaggaggcccgcgcgctgattggccgc
caacacaaactgtaccgcggcacgttggcgctgtacctgcgcggtgccgatgagcagcag
ctgcgccaacgttcggtccaggcagctaacgtcctgctcggcgccggcctgcagccggtg
cgcgagggcgatgaagtggccgcgtgcaacagctatctgcgctggttgccgatggtctac
aacccggcgcgggacacacgcaactggtacacccggctgctgtttgctcagcacgtcgcc
aatctgctgcccctctgggggcgcagcatcggtaccggcaacccgggtattaccttcttc
aaccgcggtggtgcgccgctgtcattcgacccgctgtcgcgcttcgaccgctccatgaac
ggccacctgctgctatttggccctaccggcgccggcaagtcggccaccctggtttcaatc
ctgatgcaggtcatggccgtgtaccgaccgcggctgttcatcgtcgaagcgggcaactcc
tttggcctgcagggcgactacttcgccacgctcgggctaaccgtcaacaaggttcagctc
aaaccaggcagcgatgtgagcctggcgccgttcgcccatgcccggcgcctgatagagcat
ccggaccaggtcgccagtctgtcaaccgaagaactggatgaggccgcgccggacagtggc
gagcagcgcgatgtactgggcgagctggagatcaccgcgcggctgatgatcaccggcggc
gaagccaaggaagaggcgcgcctgactcgcgcagaccgcagtctgatccgcgagtgcatc
ctcgacgccgcccggcactgcgcgacgactgagcagcaggtgctgacccgccatgtccgc
gatgccctgcgtaaggtcgccagcgacacccacctgcctgacaaacgccgcgagcgtgcg
caggagatggccgagtcgatcgacctgttctgccagggctttgaaggtgccttgttcgac
cgcgccggcacaccctggccggagagcgacgtgacgatcgtcgacctcgccacgtacgcc
cgtgagggttacgaggcgcagatgtcgatcagctacatcagcctgatgaacaccgtgaac
aacattgccgagcgcgaccagtacctcggccgcccgatcatcatggtcaccgacgaaggc
cacatcatcaccaagaacccgctgctggccccctttgtggtcaagggcacgaagatgtgg
cgcaagctcggcgcctggttctggctggcaacgcagaacatggccgacttgcccgatgcc
gcgcagaccatgctcaacatgattgagtggtggatctgcttgaacatgccgccagcggaa
atcgaggagatcgcccgcttcaagaaactcacgccggcgcagaaggtactgctgctctcc
gcgagcaaggcctcgggcaagtacaccgagggcgtggtcctgtcgaagaacctggagacg
ctgttccgcgcagtgccgccgagcctgtacctcgctttggccatgaccgagcccgaggag
aaagcccagcgctggcgattgatggaagagcaccagcagcctgagctggaagccgccctg
caggtcgcggcggagattgatcgcctgcgtggcatgtcataa

DBGET integrated database retrieval system