KEGG   Pseudomonas putida F1: Pput_2956Help
Entry
Pput_2956         CDS       T00537                                 

Definition
(GenBank) hypothetical protein
Organism
ppf  Pseudomonas putida F1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG_N
Motif
Other DBs
NCBI-ProteinID: ABQ79084
UniProt: A5W4M4
Position
3337277..3338815
Genome map
AA seq 512 aa AA seqDB search
MNMSTNSYLEYYLSLLAWIINNGIWNTLVDTGLFAAPFGAVILQEWLSARQQGADEGNKG
LLSIPRVENRLWMSYVVIMFGCMPFFPLNLSSVTFDDAASQRCGVTMARPADTAWATTFN
TIGEKSANVPVWWFLVHAMSKGITAAATAAIPCAPDIRAMRMEIDSSRINDQVLLQEVAD
FTRDCYGFSRSRLFTNRPELDESQSYDASWIGSTYLLNTPGYYDTDRSRMPRVDWPYDET
RDTSLPQLDSGAGYPTCKQWWSDGTIGLRDRLVAAVDPSLLSQLRGWLTGRTSTEVEDAT
LRELVSPRQQSLSMAPGQVFQDYGSSARGGSLTQGLNNLATNTGLALGSFSNFPAMNALR
AALPMIQAFLIMGTIISLPLVLLISTYQLKALMTITFALFTLHMLTFWWELARWIDSSML
ETLYNQVSVSDQALLSLPTAGFMDGTVTAQVIEYVMGAMFVLLPMIFIGAMSWAGYNVGS
AIQTLLTRGTEAAQTQAGRGSSQLMTGVQKLK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgagcaccaacagctaccttgagtactacctgtcgctgctggcctggatcatc
aacaacggcatctggaatacgctggtggataccgggctgttcgccgctcccttcggtgcg
gtcatcctgcaggaatggctgtcggcccgccaacagggtgctgacgaaggcaacaagggc
ctactgtcgatccctcgcgtcgagaaccggctgtggatgagctacgtggtcattatgttc
ggctgcatgccgttcttcccgctgaacctgtcctccgtgacgtttgacgatgccgcgagc
cagcgctgtggggtcacaatggccaggcccgccgacacggcctgggccacgactttcaac
accatcggcgagaagtcagcgaacgtgccggtgtggtggttcctagtgcatgccatgagc
aaaggcatcaccgccgctgccaccgcggcgattccctgcgcgcccgacatccgggcgatg
cgcatggagatcgatagttcgcggatcaacgaccaggtgctgctacaggaagtcgccgac
ttcacccgggactgctacggtttttcgcgctcgcggctgttcaccaatcgccccgagctg
gacgagtcgcagagctacgacgcgtcctggattggctcgacttacctactcaacacaccg
ggctactacgataccgatcgctcgcgaatgcccagagtcgattggccgtacgacgagacc
cgggacacctctctgcctcagctcgacagcggcgccggctaccccacctgcaaacagtgg
tggagcgacggcacgatcggactgcgcgaccgcttggtggccgctgttgatccttcattg
ctatcgcagctgcggggctggctcaccgggcgcacctctacggaggtcgaagacgccacc
ttgcgcgagctggtgagcccacggcagcaatcattgagcatggcacctgggcaggtgttc
caggactatggcagtagcgcgaggggcggatcgctgacgcaagggctaaacaacctggcc
accaataccggtttggccctaggctcgttcagtaacttcccggcgatgaatgcgctgcgc
gcggccttgccgatgatccaagcctttctgatcatgggcacgatcatcagtctgccactg
gtgctgctgatcagcacctaccagctcaaggcgctcatgacgatcacattcgcgctgttc
accctgcacatgctcaccttctggtgggagctcgcacgctggatcgactcaagcatgctg
gaaacgctgtacaatcaggtatcggtctcagaccaggcgctgttgtcgttgccgacagca
ggcttcatggacggaacggtcaccgcgcaggtgatcgagtacgtcatgggcgcaatgttt
gttttgctacccatgatctttatcggtgcaatgagttgggcgggatacaacgtgggaagt
gctatccagacccttcttactcgtggaacagaggccgctcagacacaagcaggaagaggc
tcatcacagctaatgacaggtgtccagaaactcaaataa

DBGET integrated database retrieval system