KEGG   Pseudomonas putida F1: Pput_3626Help
Entry
Pput_3626         CDS       T00537                                 

Definition
(GenBank) SAM-dependent methyltransferase-like protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ppf  Pseudomonas putida F1
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppf03009]
    Pput_3626
Enzymes [BR:ppf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Pput_3626
Ribosome biogenesis [BR:ppf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Pput_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ABQ79750
UniProt: A5W6J0
Position
complement(4049741..4050805)
Genome map
AA seq 354 aa AA seqDB search
MNTLFMHCRPGFEGEVCAEISEHAARLGVAGYAKGKPQSASAEFVCSEEGGAERLMGELR
FNQLIFPRQWARGGYVELPESDRISVLLAQLVDFPVFGSLWLEVLDSNEGKELSTFCRKF
EVPLRKALEKAGRLVDDPGRPRLLLTFISGRRVFVGVASASNSALWPMGIPRLKFPREAP
SRSTLKLEEAWHQFIPREQWEQRLGDDMTGVDLGASPGGWTYQLVRRGMLVTAIDNGPMA
ESLMDTGLVQHLMADGFTWQPKHPVDWMVCDIVEKPARTTSLIETWLGEGLCREAVVNLK
LPMKQRYAEVRRLLDRMEATFKARKIRVSIACKQLYHDREEVTCHLRRLDLKPR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaataccctgttcatgcattgccggcccggtttcgagggtgaggtttgcgccgaaatc
agcgaacatgccgcccgcctgggtgttgccggctatgccaaaggcaagccgcaaagtgcc
agtgccgagtttgtctgtagcgaggagggcggtgccgagcgcttgatgggggagctgcgt
ttcaaccagctgattttcccgcggcagtgggcacgtggcggttacgttgaactgccggaa
agtgaccgcatcagcgtactgctggcgcagttggttgacttcccggtgttcggcagcctt
tggctggaggtgctggacagcaacgaaggcaaggaattgtccactttttgccgaaagttc
gaagtgccgttgcgcaaggccctggagaaggccggccgcctggtcgacgaccccggccgc
ccacgcttgctgctgaccttcatcagcggccggcgggtatttgtcggcgtggcatcggcc
agcaacagcgccttgtggcccatgggcatcccgcgcctgaagtttcctcgcgaggcacct
agccgttcgacactcaagctggaagaggcctggcaccagttcattccgcgtgagcagtgg
gagcagcgcctgggggatgacatgaccggcgtcgacctgggagcctcaccgggtggctgg
acctaccagctggtgcgccgtggcatgctggtgacagccatcgataacgggccgatggcc
gaaagcctgatggacacaggcctggtccagcacttgatggccgatgggtttacctggcag
ccgaagcacccggtagactggatggtgtgcgatatcgtcgagaagccggcgcgtaccacc
tcgctgattgaaacctggctgggtgaggggctgtgccgcgaggcggtggtcaacctgaag
ttgccgatgaagcagcgttatgccgaagtacggcgcctgctcgaccgtatggaggcaaca
ttcaaggcacgcaagatcagggtgtcgattgcctgcaagcagctgtaccacgaccgtgaa
gaagtaacctgccacctgcggcggctcgacttgaagccacgctga

DBGET integrated database retrieval system