KEGG   Pseudomonas putida F1: Pput_3783Help
Entry
Pput_3783         CDS       T00537                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00860  Porphyrin and chlorophyll metabolism
ppf00970  Aminoacyl-tRNA biosynthesis
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
Module
ppf_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pput_3783
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pput_3783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppf01007]
    Pput_3783
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppf03016]
    Pput_3783
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ppf02048]
    Pput_3783
Enzymes [BR:ppf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Pput_3783
Amino acid related enzymes [BR:ppf01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Pput_3783
Transfer RNA biogenesis [BR:ppf03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Pput_3783
 Prokaryotic Type
   Other AARSs
    Pput_3783
Prokaryotic defense system [BR:ppf02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Pput_3783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ABQ79907
UniProt: A5W6Z7
Position
complement(4243407..4244888)
Genome map
AA seq 493 aa AA seqDB search
MTTVRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQIFD
ALRWLGIEWNEGPDVGGPHGPYRQSERGEIYAKYAKELVDAGHAFYCFCTAEELEQMRAE
QQARGETPRYDGRALLLSAEEVQRRLDAGEPHVIRMKVPSEGICVVPDMLRGDVEIPWDR
MDMQVLMKNDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPKLCY
MPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREKFSLAEMVEH
FDLSRISLGGPIFDIEKLSWLNGQWLRELPVEEFAARLQKWAFNSDYMMKIAPHVQGRVE
TFSQVAPLGGFFFEGALKLDAKLFESKKLSADQVRQVIQLILWKLESLRQWEKERITGCI
QAVVEALELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRYRLRQALDLLGGVSKK
ENKEWEKLLASIG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtacgcacgcgtattgcgccatcgcctaccggcgacccccatgtcggcact
gcctacatcgccctgttcaactactgctttgccaagcagcacggcggtgagttcatcctg
cgcatcgaagacaccgatcagctgcgctccacgcgtgagtcggagcaacagatcttcgac
gccctgcgctggcttggcatcgaatggaacgaaggcccggatgtcggcggcccgcacggc
ccttaccggcagagcgagcgtggcgaaatctacgccaaatacgctaaagagctggtagac
gccggccacgccttctactgcttctgcaccgccgaagagctggagcagatgcgtgccgag
cagcaggctcgcggcgaaaccccgcgttacgatggccgtgcattgctgctgagcgccgaa
gaagtgcagcgccgcctggacgctggcgagccgcacgtgatccgcatgaaggtgccgagc
gagggtatctgcgtggtgccggacatgctgcgcggcgatgtcgagatcccgtgggaccgc
atggacatgcaggtactgatgaagaacgacggcctgccgacgtacttcctggccaacgtg
gtcgacgaccacctgatgggcatcacccacgtgctgcgtggtgaagagtggctgccatcg
gcgcccaagctgatcaagctgtacgagtacttcggctgggagcagcccaagctgtgctac
atgccgctgctgcgcaacccggacaaatccaaactgtccaagcgcaagaacccgacctcg
gtcaccttctacgagcgcatgggcttcatgcctgaagcgatgctcaactaccttggccgc
atgggctggtcgatgcctgacgagcgcgagaagttctcgctggccgaaatggtcgagcac
ttcgacctgtcgcgtatctcgctgggcggcccgatctttgacatcgagaagctgtcctgg
ctcaacggccagtggctgcgcgagctgccggtagaggaattcgccgcacgcctgcagaaa
tgggcattcaacagcgactacatgatgaagattgccccgcacgtgcagggcagggtcgaa
accttcagccaggttgccccgttgggcgggttcttcttcgaaggcgcactcaagctggac
gccaagctgttcgaaagcaagaaactgtcggccgaccaggtgcgccaggtgatccagttg
atcctgtggaagcttgaaagcctgcgtcagtgggaaaaggagcgcatcaccggttgcatc
caggccgtggtcgaagcgctggagctgaagctgcgtgacgccatgccgctgatgttcgcc
gccatcacgggccaggccagctcggtttcggtgctggacgccatggaaatcctcggcccc
gacctgacgcgctaccgcctgcgccaggccctggacctgttgggtggagtgtcgaagaaa
gaaaacaaagagtgggaaaagctgttggcctccatcggctga

DBGET integrated database retrieval system