KEGG   Pseudomonas putida F1: Pput_4498Help
Entry
Pput_4498         CDS       T00537                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00071  Fatty acid degradation
ppf00072  Synthesis and degradation of ketone bodies
ppf00280  Valine, leucine and isoleucine degradation
ppf00310  Lysine degradation
ppf00362  Benzoate degradation
ppf00380  Tryptophan metabolism
ppf00620  Pyruvate metabolism
ppf00630  Glyoxylate and dicarboxylate metabolism
ppf00640  Propanoate metabolism
ppf00650  Butanoate metabolism
ppf00900  Terpenoid backbone biosynthesis
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01130  Biosynthesis of antibiotics
ppf01200  Carbon metabolism
ppf01212  Fatty acid metabolism
ppf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pput_4498
   00630 Glyoxylate and dicarboxylate metabolism
    Pput_4498
   00640 Propanoate metabolism
    Pput_4498
   00650 Butanoate metabolism
    Pput_4498
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pput_4498
   00072 Synthesis and degradation of ketone bodies
    Pput_4498
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pput_4498
   00310 Lysine degradation
    Pput_4498
   00380 Tryptophan metabolism
    Pput_4498
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pput_4498
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pput_4498
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pput_4498
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppf04147]
    Pput_4498
Enzymes [BR:ppf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pput_4498
Exosome [BR:ppf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pput_4498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABQ80618
UniProt: A5W908
Position
5021532..5022710
Genome map
AA seq 392 aa AA seqDB search
MNDVVIVAATRTAIGSFQGALATVPAVDLGAAVIKQLLKQTGLDPAQVDEVILGQVLTAG
AGQNPARQAAIKAGLPFSVPALTLNKVCGSGLKALHLAAQAIRCGDAEVVIAGGQENMSL
APYVMPSARTGQRMGHGQLIDSMITDGLWDAFNDYHMGITAENLVDKYGLSREQQDAFAA
ESQRKAVAAIEAGRFDAEITPIVLPQKKGEPKVFARDEQPRTDTTAESLAKLRPAFKKDG
SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLAKIAAYASAGVDPAIMGIGPVSATQRC
LDKAGWQLAELDLIEANEAFAAQALAVGNALAWDAARVNVNGGAIALGHPIGASGCRVLV
TLLHEMIKRDAKKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtggtgatcgtcgccgcaacccgtaccgccatcggcagcttccagggcgcc
ttggccactgtgcctgcggtcgacctcggcgccgccgtgatcaagcaactgctgaaacaa
accgggctggacccggcgcaggtcgacgaagtcatcctcggccaagtgctcactgccggt
gccggtcagaacccggcacgccaggcagcgatcaaggctggcctgcccttcagcgtaccg
gccctgaccctgaacaaggtctgcggctcgggcctcaaggccctgcacctggccgcccag
gcgatccgctgcggcgatgccgaggtggtgattgccggtggccaggagaacatgagcctt
gccccctacgtgatgccctcggcccgcaccggccaacgcatgggccatggccaactgatc
gacagcatgatcacggacggcctgtgggatgccttcaatgactaccacatgggcatcact
gccgaaaacctggtggacaagtacggcctcagccgtgagcagcaggatgcctttgctgcc
gaatcgcagcgcaaggcagtggcagcgattgaggccggccgtttcgacgctgaaatcacc
cccatcgtgctgccgcagaaaaagggcgagcccaaggtttttgcccgtgacgagcaacca
cgcacggacaccaccgccgagtccctggccaaactgcgcccggccttcaagaaggacggc
agcgtcaccgcaggcaatgcctccagcctgaacgacggcgccgccgccgtgcttttgatg
agcgcagcgaaggccaaggcgttgggcctgccggtgctggcgaagatcgccgcctacgcc
agtgccggggtagaccccgcgatcatgggtattggtccggtttcggcgacccagcgttgc
ctggacaaggccggttggcaactggccgaactggatctgatcgaagccaatgaggccttt
gccgcccaggcgctggccgtgggcaatgcgctggcatgggatgccgcgcgggttaacgtc
aatggaggggcgattgccctgggccacccgattggtgcttccgggtgcagggtgctggtg
accctgctgcacgagatgatcaaacgggatgccaaaaaaggcctggcgaccttgtgcatt
ggtggtgggcaaggggtggcgctggccatcgaacgctga

DBGET integrated database retrieval system