KEGG   Pseudomonas putida F1: Pput_5076Help
Entry
Pput_5076         CDS       T00537                                 

Definition
(GenBank) sulfate ABC transporter, inner membrane subunit CysW
  KO
K02047  sulfate/thiosulfate transport system permease protein
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00920  Sulfur metabolism
ppf02010  ABC transporters
Module
ppf_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pput_5076
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Pput_5076
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppf02000]
    Pput_5076
Transporters [BR:ppf02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    Pput_5076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF2273 Keratin_assoc
Motif
Other DBs
NCBI-ProteinID: ABQ81194
UniProt: A5WAN4
Position
complement(5703275..5704147)
Genome map
AA seq 290 aa AA seqDB search
MSSSSLSASAAANAARRGSATSRRILIGLGWLVFALFLLLPLVIVVSQALKNGFGTFFEA
IFEPDALSALKLTLLAVVISVPLNLVFGVSAAWCVSKYTFRGKSILVTLIDLPFSVSPVI
AGLVYVLMFGAQGLFGPWLQDHDIQIVFALPGIVLATIFVTVPFVARELIPLMQEQGTQE
EEAARLLGANGLQMFWHVTLPNIKWGLIYGVVLCTARAMGEFGAVSVVSGHIRGVTNTLP
LHVEILYNEYNHVAAFSVASLLLILALFILLLKQWSENRINRLRHSAAEE
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtccagttcatccctgagtgcaagtgccgcagccaacgccgcccgccgtggcagcgcc
acgtcacggcgtatcctgatcggccttggctggctggtgttcgccctgttcctgctgctg
ccgctggtgatcgtggtatcgcaggcactgaagaacggttttggcaccttcttcgaggcg
atcttcgaacccgatgcgttgtcggcgctgaagctgaccctgctcgccgtggttatctcg
gtgccgctgaacctggtatttggcgtaagcgctgcctggtgcgtgagcaagtacaccttc
cgtggcaagagcatcctggtcaccctgatcgacctgccgttctcggtgtcacccgtgatt
gccggcctggtctacgtgctgatgttcggcgcgcaaggcctgttcggtccgtggctgcag
gaccacgatatccagatcgtgttcgccctgccgggcattgtcctggcgaccattttcgtt
accgtaccgttcgtggcccgtgagctgatcccgctgatgcaggagcaaggcacgcaggag
gaggaggctgcacggctgctcggtgccaacggcttgcagatgttctggcacgtgaccctg
ccgaacatcaaatgggggctgatctacggcgtggtgctgtgtaccgcgcgggccatgggc
gagttcggtgcggtgtcggtggtgtcgggccacatccgtggcgtgaccaacaccttgccg
ctgcatgtggagattctctacaacgagtacaaccacgtcgcagccttcagcgtggccagc
ctgttgctgatcctggcgctcttcatcctgctgctcaagcagtggagcgagaaccgtatt
aaccgcctgcgccatagcgccgcggaggaatga

DBGET integrated database retrieval system