KEGG   Pseudomonas putida GB-1: PputGB1_0597Help
Entry
PputGB1_0597      CDS       T00650                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PputGB1_0597
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PputGB1_0597
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PputGB1_0597
    1.1.1.-  
     PputGB1_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABY96508
UniProt: B0KLA4
Position
complement(674601..675689)
Genome map
AA seq 362 aa AA seqDB search
MNDLSHTHMRAAVWHGRNDIRVEQVPLPADPAPGWVQIKVDWCGICGSDLHEYVAGPVFI
PVEAPHPLTGIQGQCILGHEFCGQIAKLGEGVEGFAVGDPVAADACQHCGTCYYCTHGLY
NICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAGALIEPLAVGMHAVKKAGSLL
GQTVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKAKEVGASVVLDPSQCDALAQ
IRALTAGLGADVSFECIGNKHTAKLAIDTIRKAGKCVLVGIFEEPSEFNFFELVSTEKQV
LGALAYNGEFADVIAFIADGRLDIRPLVTGRIGLEQIVELGFEELVNNKEENVKIIVSPG
VR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctgagccacacccatatgcgcgccgccgtctggcatggccgcaacgatatt
cgcgtcgaacaggtacccctgccagccgaccctgcgccgggctgggtacagatcaaggtg
gactggtgcggcatctgcggctccgacctgcacgaatacgtcgccggcccggtattcatc
ccggtggaggccccgcacccactgactggcattcagggccagtgcatcctcggccacgaa
ttctgcggccagatcgccaagctgggtgaaggcgtggaaggctttgcggtcggcgacccg
gtggccgcagacgcctgccagcattgcggcacctgctactactgcacccacggcctgtac
aacatctgcgagcgcctggccttcaccggcctgatgaacaacggcgccttcgccgagttg
gtcaacgtgcctgccaacctgctctaccggctgccgcagggcttccctgctgaagccggg
gcactgatcgagccgctggcagtgggcatgcatgcagtgaaaaaggcgggcagcctgctc
ggccaaaccgtggtggtggtgggtgctggtaccattggcctgtgtaccatcatgtgcgcc
aaggctgcgggagcagcgcaggtcattgcccttgagatgtcctcggcgcgcaaggccaaa
gccaaggaagtcggtgccagcgtggtgctggaccccagccagtgcgatgccctggcgcaa
atccgcgcactcactgccgggttgggggcggatgtgagctttgagtgcatcggcaacaag
cacacggccaagttggccatcgacaccatccgcaaggcgggcaagtgtgtgctggtgggc
attttcgaagagcctagcgagttcaactttttcgaactggtgtccaccgagaagcaggtg
ctgggggcgttggcgtacaacggtgaatttgccgatgtgattgcctttatcgctgatgga
cgactggatattcgccccttggtgaccgggcggatcgggctggagcagattgtcgagctg
ggcttcgaggaactggtgaacaacaaggaagagaacgtgaagatcatcgtttcaccgggc
gtgcgctga

DBGET integrated database retrieval system