KEGG   Pseudomonas putida GB-1: PputGB1_2218Help
Entry
PputGB1_2218      CDS       T00650                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputGB1_2218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG Cytochrom_C550 Cytochrom_C1
Motif
Other DBs
NCBI-ProteinID: ABY98119
UniProt: B0KNJ6
Position
complement(2475299..2475697)
Genome map
AA seq 132 aa AA seqDB search
MPTLAPHKFAIPFLLATLVSPLALAEDCAAPQRQQGEQVFARDCAACHSAQKGGPAMMGP
NLHDVVGRTPGSVPGANYSQAMKSRQASWTAQAIGAFIEQPQAAVPGTYMPYAGLPDAGE
RQAVTCFLAGLK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccctcgccccccacaagttcgcaatcccgttcctgctcgccactctggtcagc
ccccttgccctggccgaagactgcgccgcgccacaacgccagcaaggcgaacaggtgttt
gcccgtgactgcgcagcctgccattcggcacaaaagggcggcccggcaatgatgggcccc
aacctgcacgacgtggtaggccgtacacctggcagcgtgccaggcgccaactactcgcag
gccatgaagagccgccaggccagctggacggcgcaagccatcggcgccttcatcgagcaa
ccacaggccgcagtccccggcacctacatgccctacgccgggctgccggatgctggcgaa
cgccaggcggtgacctgcttcctcgccgggctcaaataa

DBGET integrated database retrieval system