KEGG   Pseudomonas putida GB-1: PputGB1_3221Help
Entry
PputGB1_3221      CDS       T00650                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg02025  Biofilm formation - Pseudomonas aeruginosa
ppg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PputGB1_3221
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PputGB1_3221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppg02044]
    PputGB1_3221
Secretion system [BR:ppg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PputGB1_3221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C DUF998 7tm_7
Motif
Other DBs
NCBI-ProteinID: ABY99113
UniProt: B0KHN1
Position
complement(3606556..3610140)
Genome map
AA seq 1194 aa AA seqDB search
MNQIWNPFKRWGLQWVTRAGLALPLLLGLGTALMLVAIWWLGPQWSWYEQKPLASVLHRS
LASLVFLLMLLLGCLVVLRIRYRRLQAERREVVAAEQDRALHFVQAQEMALSQGLDRYLD
NAGGRRALYRLPWYLVLGDEQSGKTSFVDRSDQRFTLTRIDQAQARGRQAEALAYPVGWW
VSDDAVIIDPPGIFISQNPPAGSAATDPSAPPGTQARLWEHLLGWLLRNRSRRALNGLLL
VVDLPALLHGKPEQRAALAHGLRTRLYEVSSQLGSRLPLYVVLTKFDLLDGFDQLYSKLS
AAKRESLLGFTFKLDAVDTFDAWLEEYDQQYGRLLAKLNEQVFDRLDVLGKTAPRGQLFS
LHAQLIGLRPILLTFLRETLASDRFTTPALVRGVYWSSVVQQGDIRNVFVREAAQPYKTK
LPLLEGKAQGKALAYFIQQAFRRVIYQEAGLAGDNIRVTRSKRQLLWVGSGVGILAFSVA
IGSWQRYFDINSSKATSVLAKSQEYSQREVDQRLDPTGRNLLEPLDRIRDAVAVFGDYRT
AWPGVADFGLYEGRNIGPLVDEAYLSLLSKRFLPALAGGVIDVMNAATPGSERQMAALRV
YRMIEERHSRRPEWVEDWMARQWQQAFPGQGQLQRDLMQHLKYALAYADADLPQYRQRVN
EVQQALRELPLPLRVYTGLKQQAHEQLHTSLDLRHQVGPAFDVVYQTSSGAQGEDVTLAP
MLTAKGFREYFAPRSERFAEMAMVDQWALGERSQLDYSDIDRHALTERLHNLYSADYIDS
WRRALNAFTVADFRDLDHGVTILEQLTGPAAPLQRLLETVRDNTSLASPAVVETPSEVTK
LRPPTAKPDQQQTLAIPRAFAGLGAMLQATGEKPTYYDETLGAIAAVLNYAKAVQDSPDR
GKAALQAVHQRFSMTGQDPIGTLQRIATGLPEPINHQVRKLADQTAQVLNVEALRELERR
WDAEVYSFFQQRLANRYPFVVRAPDAALDDFEAFFGPKGRLQQFNERYLKVFLKENLEAL
YSSQYGQSLIREDVIEQLELADRIRETFFDQRGKLSVQFSIEPLGLSANQRTSLLDLDGQ
LISYTHGPRQITGIVWPNTLGQQVRSNLTLLRQSGNSSSLEYRGPWSMFRLLSRGSLNGR
TATSVDLSFRTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGLLQQPLKVAQME
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaatatggaacccattcaaacgctgggggctgcagtgggtaacgcgcgcgggc
ttggcgctgccgctgttgctcgggttgggcaccgcactgatgctggtcgccatctggtgg
ctcggaccgcaatggtcgtggtatgaacaaaagccactggcgagtgtgctgcatcgcagc
ttggcaagccttgttttcctgctgatgctacttctaggctgtcttgtagtactgcgcata
cgctatcgtcgcctgcaagcggaacgtcgggaggtagtggccgccgaacaagaccgggcg
ctacattttgtgcaggcgcaagagatggcgctgagccaagggcttgaccggtaccttgac
aatgcgggtgggcgacgtgcgttgtaccggctgccctggtacctggtgttgggtgacgaa
cagtccggtaaaaccagctttgtcgaccgcagcgatcaacgctttaccttgacgcgcatc
gaccaggctcaggcacgaggccgacaggctgaagcattggcctatccggtgggctggtgg
gtcagcgacgatgctgtaatcattgacccgcccggtatttttatcagccagaatccacca
gcgggctcggcggccaccgatccctccgcgccgcctggcacccaggccaggttgtgggag
catctattgggttggctgctgcgcaacagaagccggcgggcgctcaatggtttgctgctg
gttgtcgatctaccggcactgctgcatggcaagccagagcaacgcgccgccctggcccat
ggcttacgcacacgcctttacgaagtgagcagtcagctgggatcgcgcttgccactatac
gtggtgctgaccaaattcgatctgctggatggcttcgatcagttatacagcaaactttcg
gccgccaagcgtgaaagcctgttggggttcactttcaagttggatgcggtcgatacgttc
gacgcctggctggaagagtacgaccagcaatacggtcggctgctcgccaagttgaatgaa
caggtctttgatcggctggatgtgctgggcaagacagcaccgcgcgggcagctgttctca
ctgcatgcacagctgatcggtttgcgtccgatactgctgacctttctgcgtgaaacgttg
gcgagtgaccgtttcaccacgcctgcgctggtacgaggtgtgtactggtcgtcagtggtg
cagcaaggcgacatccgcaatgtgttcgttcgcgaagcagcacagccgtacaagactaaa
cttccgctgcttgaaggcaaggctcagggcaaggcgttggcttatttcatccagcaagcc
ttcaggcgagttatctatcaagaggccggtctggcaggcgacaacatccgggtgacgcgc
agcaagcggcagttgctgtgggttggctcgggtgtaggcatcctggcgttcagtgtcgcc
atcggcagctggcaacgctacttcgatatcaatagttccaaggctaccagcgtgcttgcc
aagagccaggaatacagccagcgcgaagtggatcagcgtcttgatccgaccgggcgcaac
ttgttggagcctctggatcggatccgcgatgcggtggcggtattcggtgactatcgcacg
gcgtggccgggtgttgccgactttggcctgtatgaggggcgcaacatcggtcctctggtt
gacgaggcgtacctgagcttgctgtccaagcgctttttgcctgcattggccggcggcgtg
attgacgtcatgaacgcagcaacaccgggtagcgaacgacaaatggctgcgcttagggtt
taccgtatgatcgaagagcgccatagccgcaggcctgaatgggtcgaagactggatggca
cgtcagtggcaacaggctttccctggccaagggcagttgcagcgtgacctcatgcagcat
ctgaagtacgccttggcttatgccgatgccgatttgccgcaataccggcagcgcgtcaac
gaagtacagcaggcgttgcgtgagctacctctgccactgcgggtttacacgggactgaag
caacaggcgcacgagcaactgcacaccagcctggacctgcgtcaccaggtgggccccgca
ttcgacgttgtttaccagacatcttccggtgcccagggggaggatgtaacgctggcccct
atgctgactgccaaaggtttcagagagtactttgcgccgcgcagcgagcgattcgctgag
atggcgatggtcgatcagtgggcattgggggagcgcagccaactcgactattcggacatt
gacaggcatgcgcttaccgaaaggttgcacaacctctacagcgccgattacatcgacagt
tggcgtcgcgccttgaatgcattcaccgtggctgacttccgtgatctggatcatggtgtc
acgattctggagcaattgaccggccccgcagcccctttgcagcggctgctggaaacagtc
agagataacacttcgcttgcttcacctgcggtggttgaaacaccgagcgaagtgaccaag
ctgcgaccaccaacagccaagcctgatcaacagcaaaccttggccattccgcgggcgttt
gcagggttgggcgccatgttgcaggcaacaggagaaaaaccgacctactacgatgaaacc
cttggtgcgatagcggccgtgctgaactacgccaaggccgttcaggacagcccggatcgt
ggcaaggccgcactgcaagccgtgcatcaacgcttttcgatgacagggcaggacccgatc
ggcaccctgcaacgtattgccacaggcttgccggagccaatcaaccaccaggttagaaag
cttgccgatcagactgcccaagtgctgaatgttgaagcattgcgcgaactggagcgacgc
tgggatgctgaagtgtacagtttcttccagcaacgcctggcaaaccgctacccctttgtg
gtgagggcgcccgatgctgcgctggatgacttcgaggcgttcttcgggccgaaggggcgc
ctgcagcagtttaatgaacgctatctcaaggtcttcctgaaggaaaacctcgaggccttg
tattctagccagtacgggcaatccttgatccgtgaggatgtgatcgagcagctcgagttg
gcggatcgcattcgtgaaacgttcttcgatcagcgtggaaagctgagtgtgcaattcagc
atcgagccgttgggtctcagcgcgaaccaacgtaccagcctgctggacctggatggccag
ttgatctcctatacccatgggccacgccagatcaccggtatcgtctggccaaataccttg
gggcagcaggtgcgcagcaacctgaccctgctcaggcagagcggcaatagcagcagcctt
gagtaccgtggcccatggtcgatgttccgtttgctcagccgcggttcgctgaatgggcgc
acggcaaccagcgtggacctgagcttcaggacgggtgacggtgtgatgcgctatcggttg
aatgctgaaaaggccttcaatcccattacccagcagccgttcaagggcttccgtttaccg
cgagggttgttgcaacagccactcaaggttgctcagatggagtaa

DBGET integrated database retrieval system