KEGG   Pseudomonas putida GB-1: PputGB1_3224
Entry
PputGB1_3224      CDS       T00650                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PputGB1_3224
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppg02044]
    PputGB1_3224
Secretion system [BR:ppg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PputGB1_3224
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABY99116
UniProt: B0KHN4
Position
3612561..3613064
AA seq 167 aa
MSRSTGSVAPKERVNIKYVPATSDMQAEVELPHKMLVLGDFGLNDNRALEDRQAMRIDKH
TFNSVLSDANVSLDVSVPSMLGTTPDADLGVHLQFKSINDFGPDQIARQVPELNKLLELR
EALVALKGPLGNVPVFRKQLQHLLNNEQARKQLAQELNLVLEAPEND
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtctagaagcacgggatctgtcgcaccaaaagagcgcgtcaatatcaagtatgtcccc
gccacgagcgatatgcaggctgaggtggagttacctcacaaaatgctggttctgggagac
ttcggcctgaatgacaaccgtgcgcttgaggaccgtcaggccatgcgcatcgataaacac
acattcaacagcgtgttgagcgacgccaacgtgagcctggacgtgtctgtgccgtccatg
ctcggcacaaccccggacgccgacctgggggttcacctgcaattcaagtccatcaacgat
ttcgggccggaccaaatcgcacgccaggtacccgagctgaacaagctgctggaactgcgt
gaagcgctggtcgccctgaagggcccattgggcaacgtccccgtttttcgcaagcaattg
cagcacctgctgaacaacgagcaggcacgtaaacagcttgcccaagaactgaacctggta
cttgaagcaccagaaaatgactga

DBGET integrated database retrieval system