KEGG   Pseudomonas putida GB-1: PputGB1_3992Help
Entry
PputGB1_3992      CDS       T00650                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00010  Glycolysis / Gluconeogenesis
ppg00620  Pyruvate metabolism
ppg00640  Propanoate metabolism
ppg00680  Methane metabolism
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
ppg01130  Biosynthesis of antibiotics
ppg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_3992
   00620 Pyruvate metabolism
    PputGB1_3992
   00640 Propanoate metabolism
    PputGB1_3992
  Energy metabolism
   00680 Methane metabolism
    PputGB1_3992
Enzymes [BR:ppg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PputGB1_3992
Lipid biosynthesis proteins [BR:ppg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PputGB1_3992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABY99882
UniProt: B0KR56
Position
complement(4440426..4442387)
Genome map
AA seq 653 aa AA seqDB search
MSAAPLYPVRPEVAATTLTDEATYKAMYQQSVINPDGFWREQAQRIDWIKPFTKVKQTSF
DDHHVDIKWFADGTLNVSSNCLDRHLEERGDQLAIIWEGDDPSEHRNITYRELHEQVCKF
ANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCKS
KVVITADEGVRGGRRTPLKANVDLALTNPETSSVQKIIVCKRTGGDIAWHQHRDIWYEDL
MKVASSHCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYAALTHERVFDYRPGEV
YWCTADVGWVTGHSYIVYGPLANGATTLLFEGVPNYPDITRVSKIVDKHKVNILYTAPTA
IRAMMAEGQAAVEGADGSSLRLLGSVGEPINPEAWNWYYKTVGKERCPIVDTWWQTETGG
ILISPLPGATGLKPGSATRPFFGVVPALVDNLGNLIEGATEGNLVILDSWPGQSRSLYGD
HDRFVDTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHT
KVAEAAVVGVPHDIKGQGIYVYVTLNAGIEASEQLRLELKNWVRKEIGPIASPDVIQWAP
GLPKTRSGKIMRRILRKIATGEYDALGDISTLADPGVVQHLIDTHKAMNLASA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggctccactgtatcccgttcgtcccgaggttgcggccactaccctgaccgac
gaggccacctacaaggccatgtaccagcagtcggtgatcaacccggacggcttctggcgc
gagcaggcccagcgcatcgactggatcaagccgttcaccaaggtcaagcagacctccttc
gacgaccaccatgtcgatatcaaatggttcgccgacggcactctgaacgtttcctccaac
tgcctggaccgccaccttgaagagcgcggcgaccagttggccatcatctgggaaggcgac
gacccttccgaacaccgcaacatcacctaccgcgaactgcacgagcaggtctgcaagttc
gccaacgccctgcgcggccaggacgtgcaccggggtgacgtagtcaccatctatatgcca
atgatccccgaggctgtggttgccatgctggcctgtgcccgtatcggtgcgattcattcg
gtggtgtttggcggtttctcgcccgaggcgctggccggccgtatcatcgactgcaagtcc
aaggtggtgatcaccgccgatgaaggcgtgcgtggcggccgtcgtaccccgctcaaggct
aacgtcgacctggcactgaccaaccctgaaaccagcagtgtgcagaaaatcatcgtgtgc
aagcgcaccggtggcgacattgcctggcaccaacaccgcgacatctggtacgaagacctg
atgaaagtggcctccagccactgcgcgccgaaagagatgggtgccgaagaagcgctgttc
atcctttatacctccggctccaccggcaaaccgaagggcgtgctgcacaccaccggcggt
tacctggtgtacgcggcactgacccatgagcgcgttttcgactaccgcccgggcgaggtg
tactggtgcaccgccgacgtcggttgggtcaccggccacagctacatcgtctacggcccg
ctggccaacggcgccactaccttgctgttcgagggcgtgcctaactacccggacatcacc
cgcgtgtcgaagatcgtcgacaaacacaaggtcaacatcctctacaccgcgccaactgcc
atccgcgccatgatggccgaagggcaagcggctgtagagggagcagacggctccagcctg
cgccttctgggttcggtgggtgagccgatcaacccagaagcctggaactggtactacaag
accgtaggcaaggagcgttgcccgatcgtcgacacctggtggcagactgaaaccggcggc
attttgatcagcccgctgcctggcgccaccggcttgaaaccggggtcggcaacccgtccg
ttctttggtgtggtgccggcattggtcgataacctgggcaacctgatcgaaggtgccacc
gaaggtaacctggtaattctggactcctggccgggccagtcgcgttcgctgtacggcgac
cacgaccgcttcgtcgacacctacttcaagaccttccgtggcatgtacttcaccggcgac
ggtgcgcgccgtgacgaggatggctactactggatcaccggccgtgtggacgacgtgctc
aacgtctccggccaccgcatgggcactgccgagatcgaaagtgcgatggtcgcgcatacg
aaggttgccgaggccgcagtggttggcgtgccgcacgacatcaaggggcagggcatctat
gtctatgtcaccctcaatgccggtatcgaggccagcgagcaattgcgtctggagctgaag
aactgggtgcgcaaggaaatcggcccgatcgcttcgccggatgtgatccagtgggcgcct
gggttaccgaagactcgctcgggcaagatcatgcgtcggatcctgcgcaagatcgccacc
ggtgagtacgatgccctgggcgatatctcgaccttggccgaccctggcgtggtgcagcac
ctgatcgacactcataaggcgatgaacctggcttctgcctga

DBGET integrated database retrieval system