KEGG   Pseudomonas putida GB-1: PputGB1_4629Help
Entry
PputGB1_4629      CDS       T00650                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00071  Fatty acid degradation
ppg00072  Synthesis and degradation of ketone bodies
ppg00280  Valine, leucine and isoleucine degradation
ppg00310  Lysine degradation
ppg00362  Benzoate degradation
ppg00380  Tryptophan metabolism
ppg00620  Pyruvate metabolism
ppg00630  Glyoxylate and dicarboxylate metabolism
ppg00640  Propanoate metabolism
ppg00650  Butanoate metabolism
ppg00900  Terpenoid backbone biosynthesis
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
ppg01130  Biosynthesis of antibiotics
ppg01200  Carbon metabolism
ppg01212  Fatty acid metabolism
ppg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputGB1_4629
   00630 Glyoxylate and dicarboxylate metabolism
    PputGB1_4629
   00640 Propanoate metabolism
    PputGB1_4629
   00650 Butanoate metabolism
    PputGB1_4629
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PputGB1_4629
   00072 Synthesis and degradation of ketone bodies
    PputGB1_4629
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputGB1_4629
   00310 Lysine degradation
    PputGB1_4629
   00380 Tryptophan metabolism
    PputGB1_4629
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PputGB1_4629
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputGB1_4629
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PputGB1_4629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppg04147]
    PputGB1_4629
Enzymes [BR:ppg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PputGB1_4629
Exosome [BR:ppg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PputGB1_4629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABZ00516
UniProt: B0KGX0
Position
5165495..5166673
Genome map
AA seq 392 aa AA seqDB search
MNDVVIVAATRTAIGSFQGALASVPAVDLGAAVIKRLLEQTGLDPAQVDEVILGQVLTAG
AGQNPARQAAIKAGLPFSVPALTLNKVCGSGLKALHLATQAIRCGDAEVVIAGGQENMSL
APYVMPSARTGQRMGHGQLIDSMITDGLWDAFNDYHMGITAENLVDTYSLTREQQDAFAA
ESQRKAVAAIEAGRFDAEITPILLPQKKGEPKVFARDEQPRPDTTAESLGKLRPAFKKDG
SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLAKVAAYASAGVDPAIMGIGPVSATQRC
LDKAGWQLAELDLIEANEAFAAQALAVGKALEWDAARVNVNGGAIALGHPIGASGCRVLV
TLLHEMIKRDAKKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtggttatcgtcgccgcaacccgtaccgccattggcagcttccagggcgcc
ctggcctccgtgcctgcggtcgacctcggcgccgccgtgatcaagcggctgctggagcag
accgggctggacccggcgcaagtcgacgaagtcatcctcggccaggtgctcaccgccggc
gccgggcagaacccggcgcgccaggctgcgatcaaggccggcctgcccttcagcgtaccg
gccctgaccctgaacaaggtctgcggctcgggcctcaaggccctgcacctggccacccag
gccatccgctgcggcgacgccgaggtggtgattgccggtggccaggagaacatgagcctt
gctccctacgtgatgccctcggcccgtactggccagcgcatgggccatggccaactgatc
gacagcatgatcaccgatggcctgtgggatgcgttcaatgactaccacatgggcatcact
gccgagaacctggtggacacgtacagcctcacccgcgaacagcaggatgcctttgccgcc
gaatcgcagcgcaaggcggtggcggcgatcgaggccggccgcttcgacgcggaaatcacc
cccatcctgctgccacagaaaaagggcgagcccaaggtcttcgcccgtgacgagcagcca
cgcccggacaccaccgccgagtccctgggcaaactgcgcccggccttcaagaaggacggc
agcgtcactgcgggcaatgcctccagcctgaatgacggcgccgccgccgtgttgttgatg
agcgcggccaaggccaaagccctgggcctgccagtgctggcgaaggtcgccgcctatgcc
agtgccggggtagacccggcgatcatgggtatcggcccggtttcggcgacccagcgttgc
ctggacaaagccggttggcagttggccgaactggacctgatcgaagccaacgaagccttt
gccgcacaggcgctggccgtgggcaaggcgctggagtgggatgccgcgcgggtcaacgtg
aatggcggagcgattgccctgggccacccgattggtgcttccgggtgccgcgtgctggtg
accttgctgcacgagatgatcaagcgcgatgccaagaaaggcctggcgaccttgtgcatt
ggcggtgggcaaggtgtggcactggcgatcgagcgctga

DBGET integrated database retrieval system