KEGG   Pseudomonas putida GB-1: PputGB1_4672Help
Entry
PputGB1_4672      CDS       T00650                                 

Definition
(GenBank) exodeoxyribonuclease V, gamma subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PputGB1_4672
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppg03400]
    PputGB1_4672
Enzymes [BR:ppg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PputGB1_4672
DNA repair and recombination proteins [BR:ppg03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PputGB1_4672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: ABZ00559
UniProt: B0KHT8
Position
complement(5212908..5216387)
Genome map
AA seq 1159 aa AA seqDB search
MATTTLHPGFMIVHGNRLDDLRSLVVSWMRRYPLAPLENEIALVQSNGIAQWLKLALAED
PLEDDLGGCGIAAAIDVQLPGSFMWQLYRSVLGRDEIPEVSLLDKAPLTWRLMRLLPALI
ERPHFEPLRRFLTDDSDLRKRYQLAERLADLFDQYQVYRADWLKDWAAGEHVLNTARGER
KALPPGNRWQAELWRALLEDVGEQGMAQSRAGVHQRFIERINSLEQAPAGLPPRVIVFGI
SSLPAQALEALAGLARFSQVLLCVHNPCRHHWADIVADKDLLRHQYKRQQRKQGMPLQLD
DQSLHQHAHPLLAAWGKQGRDYINLLDSYDDPGSYQGVFSDGRIDLFSDGSPTTLLNQLQ
DDILELRPLTETRELWPPVDTAKDRSIRFHIAHSPQREVEILHDQLLARFSADATLRPRD
VIVMLPAIDTYAPHIRAVFGQLQRNDPRYIPFTLTDQGQRGREPLLIALEHLLKLPDSRF
AVSEVLDLLDVPAVRARFGIRENDLPTLHRWIEGAGIRWGLNAEQRASLGLPAGLEQNSW
RFGLRRMLLGYAVGVGVACDGIEPYDEIGGLDAALIGPLVALLDALEVACQALSEPATVT
QWGERLHALLQVFFLAEGERDEYLLMQLQDLRDSWLEVCETVGLQDPLPLAVVREAWLSG
LDQGKLSQRFLAGSVNFCTLMPMRAIPFRVVCLLGMNDGDYPRAQQPLDFDLMASDYRPG
DRSRREDDRYLLLEALLSARDQLYVSWVGRSIRDNSERPASVLIGQLRDHIATGWHLAGM
QQGQPAEPGEQLLHALTQEHPLQPFSARYFQKGSPLFSFAHEWQLLHQHGETDEQGEPGL
PPYLGDEALSLTQLNDFLRHPVRHFFSQRLKVYFEALEAPTPDEEPFVLDTLQRYGASES
LLGAALAEPDNAEQALRAQARRLQACGLLPLAGFGESLQSELIEPLPDLLQRHQQLLQRW
PQLVEGALPVHFEHAQHRLEGWLGRVFQAQDQSLLSITTVPNTISAGRNNLKWHRLIAPW
VTHLVACAAGYPYNSALVASDLTLLLAPLPQAQAAQLLGDLLVARQAAMNAPLPVAAKTA
FAWLAQDDADKALAAAARAYEGDERTSFGERSESIALARQFRDFAALTADETFEGWCETL
YRPLFTAPWQTLGNPEKGA
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atggctactaccactctccaccccggcttcatgatcgtccacggcaaccgcctcgacgac
ctgcgcagcctggtagtgagctggatgcgtcgctatcccctggcgccgctggaaaacgaa
atagccttggtgcaaagcaatggcatcgcccaatggctcaagttggccctggccgaagac
ccgctggaagatgacctgggcggctgtggcatcgccgccgcaatcgatgtgcaactaccc
ggtagcttcatgtggcagctataccgcagcgtgctgggccgtgacgaaattcccgaagtt
tccctgctcgacaaggccccactcacgtggcgcctgatgcgcctgttacccgccctgatc
gaacgcccccatttcgagccgctgcggcgcttccttaccgacgacagcgacctgcgcaag
cgctaccagctagccgaacggctagcggacctattcgaccagtaccaggtctaccgcgcc
gactggctcaaggactgggccgcaggcgagcatgtcctcaacaccgcccgtggcgagcgc
aaagcgctgccgccgggcaaccgttggcaagccgagttgtggcgagcattactggaagat
gttggcgagcagggtatggcgcagagccgtgccggggttcaccaacgcttcatcgagcgg
atcaatagcctggagcaggcacctgcagggctgccaccgcgggtgatcgtgtttggcatc
tcctcactacccgcccaggccctggaagcactggccggtctggcgcgtttcagccaggtg
ctgttgtgcgttcataacccatgccgccaccactgggccgacatcgttgccgacaaggac
ctgttacgccaccagtacaaacgccagcaacgcaagcagggcatgcccctgcaactggat
gaccagtcgttgcaccagcatgcccatccgttgctggccgcctggggcaaacaaggccgc
gactacatcaacctgctcgacagctacgacgacccgggcagctaccagggcgtgttcagc
gatggccgcatcgacctgttcagtgacggttcgcccaccacgctgctcaatcaactgcag
gacgacatcctggagttgcgcccgctcaccgaaacccgtgagctgtggccgcccgtggac
actgcaaaggatcgctcgatccgcttccacatcgcccatagcccgcaacgtgaagtggaa
atcctccacgaccaactgttggcccgcttcagcgccgacgcaactttgcgcccgcgtgac
gtgatcgtcatgctaccggccatcgacacttacgcgccgcacatccgcgctgtctttggc
cagttgcagcgcaacgacccgcgctacatcccgttcaccctgaccgaccagggccagcgc
ggccgcgaacctttgctgatcgctcttgagcacttgctcaaactgccagacagccgtttc
gcggtcagcgaagtgcttgacctgctggacgtgccggcagtgcgcgctcgctttggtatt
cgcgaaaacgacctgcccacgctacaccgctggatcgagggggccggcatacgctggggc
ctcaacgccgagcagcgggccagtcttggtttgcccgccgggctcgaacagaacagttgg
cgcttcggcctgcggcgtatgctgttgggctatgcagtgggtgtgggcgtggcctgtgac
ggcattgaaccctacgatgaaatcggtggcctggacgctgcactgatcggcccactggtc
gcgctgctcgatgcgctcgaagtcgcctgtcaggccttgtccgagcccgccaccgtcacg
cagtggggcgagcgcctgcatgctttgctacaggtgtttttcctggccgagggcgagcgt
gacgagtacctgctgatgcaactgcaagatctgcgcgatagctggcttgaagtgtgcgag
accgttggcctgcaagacccgttgccgctggccgtggtgcgtgaagcctggctgtcgggc
ctcgatcagggcaagctgtcacagcgcttcttagccggctcggtgaacttctgcaccctg
atgcccatgcgcgccatcccgttccgggtggtttgcctgctgggcatgaacgatggcgac
tacccgcgcgcccagcaaccgctggacttcgacttgatggccagcgactaccgccccggt
gaccgctctcgccgcgaagacgaccgttacctgctgctggaggcgctgttgtcggcacgc
gaccagctgtatgtcagttgggtcgggcgcagtatccgtgacaatagcgaacgcccggcc
tcggtactgatcggccagttgcgcgatcacatcgccacgggatggcatctggccggcatg
cagcaggggcagccagccgaaccgggcgagcaactgctgcacgctctgactcaggagcat
cccttgcagccgtttagcgcacgctacttccagaaaggcagcccgttgttcagctttgcc
catgaatggcaactgctgcaccagcatggcgagacagatgaacagggcgagcccggcctg
ccgccatacctaggtgatgaagccctgagcctgacccaactgaatgactttctgcgccat
ccggtacggcactttttcagccagcgcttgaaggtgtactttgaagcgctggaagcacca
accccggacgaagaacccttcgtcctcgatacgctgcaacgctatggcgccagtgaaagc
ctgcttggcgcagccttggccgagccggacaatgccgaacaggccttgcgtgcccaggcc
cggcgcctgcaggcctgcggtttgctgccgctggccggtttcggagaatcgctgcaaagc
gagttgatcgaaccgctacccgatttgttgcaacgtcaccaacagctgctgcaacgctgg
cctcagctggtcgagggcgctttgccggtgcatttcgagcacgctcagcaccgtctcgaa
ggctggttgggccgggtgttccaggctcaggaccagagcctgctcagcatcaccacggta
cccaacacaatcagcgccgggcgcaacaacctcaagtggcatcgtctgatcgcaccttgg
gttacgcacctggtcgcctgtgcggccggctatccctacaacagtgcactggtagccagc
gacctgaccctgttacttgcaccgctaccgcaagcacaggctgctcagctgttgggcgac
ctgctggtggcccgtcaggcggcgatgaatgcgccgctgcccgtcgcggccaagaccgcg
ttcgcctggctggcccaggacgacgccgacaaggctttggccgccgcagcccgtgcctat
gaaggcgacgagcgcaccagctttggcgagcgaagtgagagcatcgctctggcccgccag
ttccgcgactttgctgcactgacggctgacgaaacctttgaaggctggtgcgaaaccttg
taccgcccgttgttcaccgccccttggcagaccctgggcaacccggagaaaggcgcatga

DBGET integrated database retrieval system