KEGG   Pelodictyon phaeoclathratiforme: Ppha_0324Help
Entry
Ppha_0324         CDS       T00731                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, N subunit
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
pph00860  Porphyrin and chlorophyll metabolism
pph01100  Metabolic pathways
pph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pph00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ppha_0324
Enzymes [BR:pph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Ppha_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ACF42657
UniProt: B4SC77
Position
308907..310169
Genome map
AA seq 420 aa AA seqDB search
MMQVPGDIQVIKEDNVTHSFCGLACVGWMYQKIKDSFFLILGTHTCAHFLQNALGMMIFA
KPRFGIALMEEGDLSKQEPSLQDIISEIMADHHPSVIFLLSSCTPEVMKVDFKGLAHLLS
TPDVPVLFVPASGLVYNFTQAEDSVLAALVPFCPEAPAGQKKVVFLGSVNDVTADDLRAE
AEELGIPVGGFLPESRFDKMPAIGPDTVLAPIQPYLSRVAVKLSRERGCSVLHSLFPFGP
DGTRAFWEDLAREFGITVDLRDREKAAWEKIRSQTELLKGKKIFLTADTMMELPLARFLH
SAGADVVECSSAYINKKFHARELEALDGVRVVEQPNFHRQLEDVRRIKPDLIITSLMTAN
PFVGNGFVVKWSMEFMLMSIHSWSGVITLANMFVSPLQRRSKLPAFDKEVWLEGVMPSAE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggttcccggagatattcaggtaatcaaggaagataacgttacacacagtttt
tgtggccttgcctgtgttggatggatgtatcagaagatcaaggacagcttttttcttatt
cttggaacgcacacctgtgcccattttctgcagaatgcgctcggcatgatgatctttgcc
aagccgcgttttggtattgcgctcatggaagagggtgatctttcgaagcaggagccaagc
cttcaggatattatcagtgaaatcatggccgatcaccatccgtccgtaatttttctgctc
tcttcatgtacccctgaggtcatgaaggttgacttcaaagggctggcccatctgctcagt
acaccggatgtaccagtactttttgttccggcaagtggtctggtctacaattttacccag
gctgaagactcagtccttgccgctcttgtacctttctgtcccgaagccccggcaggtcag
aaaaaggtggtttttctcggttccgtcaacgatgtaacggccgacgatctgagggcagag
gccgaagagcttgggattccagtcggtggctttcttcctgaatcccgtttcgacaaaatg
ccggctattggccccgataccgtccttgctccgattcaaccctatctttcacgggttgcc
gtcaaactttcccgtgaacggggatgcagcgttcttcattcactctttccgttcggcccc
gatggaaccagagccttctgggaggatctggcccgtgaatttggcattaccgtcgatctt
cgtgatcgcgaaaaagctgcgtgggagaagatccgcagccagacagagcttctgaagggc
aaaaagatctttctgactgccgacaccatgatggagctgccacttgcgcgttttcttcat
agtgcaggcgccgatgtggttgagtgcagcagcgcctatatcaacaaaaaatttcatgcg
cgtgaacttgaggcacttgatggcgttcgcgttgtcgagcagccgaactttcatcgccag
cttgaggatgttcggcgtatcaagcccgatttgatcattacctcgctgatgacagcaaac
ccttttgttggcaacggttttgttgtgaaatggagcatggagttcatgctgatgtccatt
catagctggtcgggagttattaccctcgcgaacatgtttgtttcaccgctccagcgccgc
agcaagctgccagcgttcgacaaggaagtctggcttgaaggtgtcatgccaagcgctgaa
taa

DBGET integrated database retrieval system