KEGG   Pelodictyon phaeoclathratiforme: Ppha_0650Help
Entry
Ppha_0650         CDS       T00731                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
pph00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pph01100  Metabolic pathways
pph01110  Biosynthesis of secondary metabolites
pph01130  Biosynthesis of antibiotics
pph01230  Biosynthesis of amino acids
Module
pph_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ppha_0650
Enzymes [BR:pph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ppha_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACF42949
UniProt: B4SDV8
Position
666440..667210
Genome map
AA seq 256 aa AA seqDB search
MSYLSRILEEKEREVGELASEHPARRYAELQGSLAPTRDFTGALRRTGRGLRLIAEIKKA
SPSRGLIVPDFDPVNIARRYGELGAAAYSVLTDRTFFQGSIDYLQMVSRSFQLPVLRKDF
IIDESQIFQSRLTGADAILLIVAALDSCQLGDYLQLAASVGLHVLVEVHDRKELDRAIEK
GAPIIGVNNRDLKDFSLKLETSLSLRPFIPSDVLAVSESGLKSSADIALIEQASFDAVLI
GEGLYTSPELGRITWS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagctatctgagcaggatactggaggagaaagagcgggaggtaggggaacttgccagt
gagcatcccgcccgtcgttacgctgagttgcagggctctctggcgcccacccgtgatttt
accggcgcactccggcgcaccggcagggggttgcggctgattgccgagattaaaaaagcc
tctccttcgagaggtcttattgttcctgattttgatccggtcaacattgcacgccgctat
ggagagcttggcgctgcggcctattctgtgctgactgaccgcactttttttcagggttca
atcgactatcttcagatggtgagccgctcatttcagttgcctgtgctgcgcaaggatttc
attatcgatgagtcccagatttttcagtcccgtctgacaggagccgatgccattctgctt
atcgtggctgcgcttgattcctgtcagcttggcgattacctgcagttggcggcctctgtt
ggcctgcatgtgcttgtggaggtgcatgaccgcaaggagcttgacagggcgattgaaaag
ggcgcaccgatcatcggtgtcaataatcgggatctgaaagacttttccctcaaacttgag
acatcgctctcgcttcgtccctttattccttctgatgttcttgctgtttccgaaagtggt
ttgaaaagctccgctgatatcgctcttatcgagcaggcatcgtttgatgccgtgctgata
ggagagggactgtataccagccccgagcttggcaggattacctggtcatag

DBGET integrated database retrieval system