KEGG   Pelodictyon phaeoclathratiforme: Ppha_1796Help
Entry
Ppha_1796         CDS       T00731                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
pph00860  Porphyrin and chlorophyll metabolism
pph01100  Metabolic pathways
pph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ppha_1796
Enzymes [BR:pph01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ppha_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 MCM AAA_33 Sigma54_activat AAA_22 AAA AAA_29 DUF815 AAA_30 AAA_28 AAA_18 MMR_HSR1 ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: ACF44028
UniProt: B4SBH4
Position
complement(1900080..1901255)
Genome map
AA seq 391 aa AA seqDB search
MTQTETAAKKTAAKKPAAVKAKASSTVTTTPELKKAVKPAAKKKSGQAFPFTAIVGQEEM
KLSLILNIIDPRIGGVLVMGHRGTGKSTTVRALAEVLPLIERVEGDTYNRTVDQYVEGEE
AKKGHKAIDPSSLKIEKIPVPVVDLPLGATEDRVCGTIDIEQALTSGVKAFEPGLLAQAN
RGFLYIDEVNLLDDHLVDVLLDVAASGQNVVEREGISIRHPARFVLVGSGNPEEGELRPQ
LLDRFGLHARIITILDIAKRVDIVKRRRDFDEDPDAFMKKYGRDQQKLQKKIQTAKELLS
SVTMDDSVLTDIAKLCMNLGIDGHRGELTITRTAFAHAAFLGETVVTMKHVKDIAGLCLR
HRLRKDPLETLDAGEKIDRELAKILGEAEAV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactcagactgaaacggctgcgaaaaaaactgctgcaaagaagcctgctgcggtaaag
gctaaggcgagttcaacggtcacaactactcctgaactcaaaaaagcagttaagcctgct
gcaaaaaagaagtctggacaagcctttccttttacagcaattgtcggtcaggaggaaatg
aagctcagtctgatcctcaatatcattgacccgagaatcggaggtgtgctcgtcatggga
cacaggggtaccggaaaaagtaccacggtcagagcgcttgctgaagtgcttccactgatt
gaacgggttgagggtgatacatacaatcgtaccgtcgatcaatatgttgaaggtgaggag
gcaaaaaagggccataaggctattgatccgtcatcgctcaaaatcgaaaaaattcctgta
ccagttgtagatcttccgcttggtgctacagaagaccgtgtctgcggtaccattgatatt
gagcaagcgcttaccagcggcgtaaaagcatttgaaccaggcctgcttgcccaggcgaat
cgcggatttctctatattgatgaggtcaacctgcttgatgaccatcttgttgacgtgctg
cttgatgttgctgcgagtggtcaaaacgtggttgaacgtgaaggtatcagtattcgccat
ccagcccgttttgtgcttgttggttccggtaacccggaagagggcgaacttcgtccccag
cttcttgaccgttttggtctgcatgcccgtatcattacgattcttgatattgcaaaacga
gtcgatattgtcaagcgccgtcgtgattttgatgaagatccggatgcatttatgaaaaag
tacggtcgtgaccagcagaagctccagaaaaagattcagacagccaaagagctgctttcg
tcagtgaccatggatgacagtgtgcttaccgatattgcaaagctctgtatgaaccttggt
attgatggtcaccgtggtgaacttaccattacccgtaccgcttttgcccatgcagcattc
cttggtgaaacagtagtgaccatgaagcatgtcaaggatatcgcaggcctctgtctgcgt
caccgtctgcgcaaggatcctcttgagacccttgatgccggtgaaaaaattgatcgtgaa
ctcgctaaaatcctcggagaagcggaagcagtataa

DBGET integrated database retrieval system