KEGG   Pelodictyon phaeoclathratiforme: Ppha_2334Help
Entry
Ppha_2334         CDS       T00731                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
pph00630  Glyoxylate and dicarboxylate metabolism
pph01100  Metabolic pathways
pph01110  Biosynthesis of secondary metabolites
pph01120  Microbial metabolism in diverse environments
pph01130  Biosynthesis of antibiotics
pph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ppha_2334
Enzymes [BR:pph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Ppha_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACF44529
UniProt: B4SEB0
Position
complement(2408806..2410107)
Genome map
AA seq 433 aa AA seqDB search
MNTEDIKGFFASREQLDMADYLTLDYYLECVGDIETALAHFCSEQSTAQWKRVDHDEDFR
PKYAARVISLTIEGELEALSYPVVHFETGPIHACRVTIAHPHRNFGAKLPNLLTAVCGEG
VFFTPGVPVVKLLDIGFPEAYLRAFDGPKFGIDGIRDLLQAYDRPIFFGVVKPNIGLSPA
NFAEIAYQSWLGGLDIAKDDEMLADVDWSSLIERSRVLGEARARAEKETGEPKIYLANVT
DEVDRLLEQHDIAVSNGANALLINALPVGLSAVRMLARHTKVPLIGHFPFIAAFSRMEKY
GVHSRVMTKLQRLAGLDSIIMPGFGSRMMTPEEEVKDNIAECLQEFGHIRRSLPVPGGSD
SALTLETVYRKVGSVDFGFVPGRGIFGHPMGPRAGAMSIRQAWEAIEQGISLETYAVGRP
ELEVMVDGINRKK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgaggatataaaaggtttctttgcatcaagggagcagctcgatatggctgac
tacctgacgctggattactacctggagtgtgtgggagatatagagacggcgcttgcccat
ttctgcagtgaacaatcgacagcacagtggaaacgtgttgatcatgatgaagattttcgt
ccaaagtatgccgccagggtgatcagtctgacgatagagggggagcttgaggctctcagc
tatccggtcgtgcatttcgaaacaggccctattcatgcatgccgcgtcactattgcccac
ccgcatcggaattttggcgccaagctgccgaatctgctcaccgctgtttgtggggaggga
gttttttttactcccggtgtgccggtggtgaagctgcttgatatcggttttccggaggct
tatctgagggcttttgatggccccaaatttggtattgatggtattcgtgatcttcttcag
gcctatgaccgcccgatttttttcggagtagtgaagccaaatatcggactcagtccagcc
aattttgccgagattgcctatcagagctggcttggagggcttgatattgccaaggatgac
gaaatgcttgccgatgttgactggtcttccctgattgagcgatcccgagtactgggagag
gcaagagctcgggcggaaaaggagaccggagagccaaaaatttatcttgcaaatgttacg
gatgaggttgaccgacttcttgagcagcacgacattgccgtcagcaatggagcgaatgct
ttgctgatcaatgctctgccggttggactcagcgctgtcagaatgcttgcccggcatacg
aaggtgccacttattggccattttccctttattgcggctttcagcaggatggaaaaatat
ggtgtccattcaagggttatgaccaaacttcagcgccttgccggtcttgattcgattatt
atgcccggttttggcagcaggatgatgacccctgaagaggaggtaaaggacaatattgcc
gagtgtctgcaggagtttggtcatatcaggcgttcgcttcccgttccaggaggcagtgat
tcagcgcttacgcttgaaaccgtctaccggaaagtggggagtgtcgattttggttttgta
ccgggtcgggggatttttggccatcctatgggccccagagccggagccatgagtatccgt
caggcatgggaggctattgagcagggtatctctcttgaaacttatgctgttggccgccct
gagcttgaggtgatggtcgatgggataaacagaaaaaagtaa

DBGET integrated database retrieval system