KEGG   Pseudoalteromonas phenolica: PP2015_1689Help
Entry
PP2015_1689       CDS       T04165                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pphe  Pseudoalteromonas phenolica
Pathway
pphe00071  Fatty acid degradation
pphe00072  Synthesis and degradation of ketone bodies
pphe00280  Valine, leucine and isoleucine degradation
pphe00310  Lysine degradation
pphe00362  Benzoate degradation
pphe00380  Tryptophan metabolism
pphe00620  Pyruvate metabolism
pphe00630  Glyoxylate and dicarboxylate metabolism
pphe00640  Propanoate metabolism
pphe00650  Butanoate metabolism
pphe00900  Terpenoid backbone biosynthesis
pphe01100  Metabolic pathways
pphe01110  Biosynthesis of secondary metabolites
pphe01120  Microbial metabolism in diverse environments
pphe01130  Biosynthesis of antibiotics
pphe01200  Carbon metabolism
pphe01212  Fatty acid metabolism
pphe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP2015_1689
   00630 Glyoxylate and dicarboxylate metabolism
    PP2015_1689
   00640 Propanoate metabolism
    PP2015_1689
   00650 Butanoate metabolism
    PP2015_1689
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PP2015_1689
   00072 Synthesis and degradation of ketone bodies
    PP2015_1689
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PP2015_1689
   00310 Lysine degradation
    PP2015_1689
   00380 Tryptophan metabolism
    PP2015_1689
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PP2015_1689
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP2015_1689
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PP2015_1689
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pphe04147]
    PP2015_1689
Enzymes [BR:pphe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PP2015_1689
Exosome [BR:pphe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP2015_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALO42191
UniProt: A0A0S2K293
Position
I:complement(1944624..1945802)
Genome map
AA seq 392 aa AA seqDB search
MSNEAVVIVAAKRTPMGGFMGALSGASATELGATAIKSVMSETGLTDASIDEVIMGCVLP
AGLGQAPARQAMLHAGLARSTGATTINKVCGSGLKAAMLAHDLIKAGSISSAVAGGMESM
TNSPYFIPKARGGMRMGHGEIKDHMMADGLEDAYDNKAMGCFAQATADDYGITREEMDEF
ALSSLSKANEAIENGSFNNEVVPHVLKTRKGDVEVAIDEQPGNARPDKIPGLRPAFKKDG
TITAANSSSISDGAAALILMSESEAKKQGLTPLCKVVAHATHSQAPAEFTVAPVGAMNTL
LEKAGWDKADVDLWEINEAFAMVTMLAIKELGLEQSKVNVNGGACALGHPIGASGARILV
TLIHALRNRGLSKGVASLCIGGGEAVALAVEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaagcagttgtaatcgtagcagcaaaacgtacccctatgggtggctttatg
ggtgcactatcaggcgcaagcgcaacagagcttggcgcaactgcaatcaaaagcgttatg
agcgaaacagggctaacggacgcatcaattgatgaagtgatcatgggttgtgtattacca
gcaggtcttggtcaagcaccagcacgtcaagctatgttgcatgccggtctagcacgttct
actggcgcaacaactattaacaaggtttgtggctcaggtttaaaagcagccatgcttgct
catgacctcattaaagcgggcagcatttcatctgcagtcgcaggcggcatggaaagcatg
actaactcaccgtatttcattccaaaagcgcgtggcggtatgcgtatgggtcatggtgag
attaaagaccacatgatggccgatggtcttgaagatgcttacgacaacaaagctatgggt
tgttttgcacaagcaactgcggatgattatggcattacgcgtgaagaaatggacgagttt
gcgcttagctctctaagcaaagcaaatgaagcgattgaaaacggcagcttcaataacgaa
gtagtccctcatgttttaaaaacgcgtaagggtgacgttgaagtcgccattgacgagcag
ccaggcaatgcgcgtccggacaaaattccaggtttacgtccagcattcaaaaaagatggc
acgattaccgcagctaactcttcttctatctcagatggtgcagctgcattgattctaatg
agcgaatcagaagcgaagaagcaaggcttaacaccactttgtaaagtggttgctcacgcg
actcactcgcaagcgccagcagaattcacggttgcaccagttggcgcaatgaacacgcta
cttgaaaaagcgggttgggacaaagctgacgtagatttatgggaaatcaatgaagcattt
gccatggtgactatgctagcaattaaagagcttggccttgagcagagcaaagttaacgtt
aatggtggtgcatgtgcccttggtcacccaatcggtgcaagtggtgcgcgtatcctagtt
actctaattcatgccctacgtaatcgcggcctttcaaaaggtgttgcatcactgtgtatc
ggtggtggtgaagcggttgcactggcagtcgaagtttaa

DBGET integrated database retrieval system