KEGG   Pseudoalteromonas phenolica: PP2015_2161Help
Entry
PP2015_2161       CDS       T04165                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pphe  Pseudoalteromonas phenolica
Pathway
pphe00260  Glycine, serine and threonine metabolism
pphe01100  Metabolic pathways
pphe01110  Biosynthesis of secondary metabolites
pphe01120  Microbial metabolism in diverse environments
pphe01130  Biosynthesis of antibiotics
pphe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP2015_2161
Enzymes [BR:pphe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PP2015_2161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ALO42658
UniProt: A0A0S2K3X5
Position
I:2501986..2503002
Genome map
AA seq 338 aa AA seqDB search
MTNKIIDLRSDTVTQPCKAMRDAMANAPVGDDVFGDDPTVNALQQKAAELTGHEAALFAP
SGTQSNLLALLAHCQRGDEYIVGQDAHTYKYEGGGAAVLGSIQPQPIEFAANGSIPLDIA
KKKIKPNDHHFARTRLLSIENTVGGQALPMSYLDEARAFCNDTGLGLHLDGARVFNASVH
HNVPVSAITSQMDSVSICLSKGLGTPLGSILCGPKDFIHEAHKWRKMLGGGMRQAGIVAA
AGIFALDNNIERLIEDHHNAEFLATELTEIDELTVTKQFTNMLFVEYQGSLSPSELADKL
LEKGIKICAGEHMRFVLHKDVSHADCKRVVEGFKDIFS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgaataaaataatcgacctgcgcagtgatactgtcacccaaccttgtaaagccatg
cgtgatgcaatggccaacgcgcctgttggcgacgacgtgtttggtgatgatccaaccgtg
aatgcactacaacaaaaagccgcagagctaaccggccatgaagcggcattatttgcccca
agtggcacacaaagcaacttgcttgccctactcgcccattgtcagcgcggtgacgaatat
attgttggtcaagacgcccatacttataaatacgaaggcggtggcgcagcagtattgggc
agtattcaacctcagccaatagagtttgcagcaaacggatctattccactcgatatcgcg
aaaaagaaaatcaaacctaacgaccatcactttgcacgcacccgtttgttatcaatcgaa
aataccgtaggcgggcaagctttacctatgtcttacttagatgaggcgcgtgcgttttgt
aacgacacagggcttggtttacaccttgatggtgcacgggtattcaacgcatcggtgcat
cacaatgtacctgtatcggcaattacttcgcagatggattcggtttctatttgtttatcg
aaaggtttaggcacgccacttggcagtattttatgtggcccgaaagactttattcatgaa
gctcacaagtggcgcaaaatgctcggtggtggtatgcgccaagctggtattgtcgcagcc
gccggtatattcgcattggacaacaacatcgaaagattaatagaagatcaccacaatgct
gagtttttagccacagaacttaccgaaatagatgaactaacagtcacaaagcaattcacc
aatatgttgtttgttgaatatcaaggctcgctttcaccctcagagcttgcagacaagctg
ctagaaaaaggcatcaaaatttgtgctggcgagcatatgcgctttgtgctgcataaagat
gtgagccacgcagattgtaaacgcgttgtagaagggtttaaggatatttttagttag

DBGET integrated database retrieval system